KEGG   Archaeoglobus fulgidus DSM 4304: AF_1488Help
Entry
AF_1488           CDS       T00011                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
afu00760  Nicotinate and nicotinamide metabolism
afu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AF_1488
Enzymes [BR:afu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     AF_1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AAB89761
UniProt: O28784
Position
complement(1345418..1345942)
Genome map
AA seq 174 aa AA seqDB search
MARPLRALIFGRFQPFHLGHLKVTKWALEKFDELVLLVGMANESHTVLNPFTAGERIWMM
REALKDEGVDLSRIITATVPTMSVYVGHAFYIINLVPKVDSIITRNPVIAQVFHDAGLEV
IAPPEFDRNLYRGSYIRKLMLEDGNWRELVPKKVAAIIDEIGGVERLKKAASRD
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggccagaccattgagggccctgatatttggcaggtttcagcccttccacctcggccat
cttaaggtcacgaaatgggcacttgaaaagttcgatgagctggttctgctggttggtatg
gccaatgaaagtcacacagtcctcaatccattcacggcaggagagagaatctggatgatg
agagaggctttgaaagatgagggagttgatttaagcagaattataaccgcgactgttcca
acgatgagcgtgtacgttggccacgctttttacataataaacctcgttccgaaagtggat
tcgataataacgagaaatcccgttatagctcaggttttccacgacgctggactggaggtt
attgctccccccgaatttgacagaaacctctacaggggcagctacatcagaaaactcatg
ctcgaagatgggaactggagagagctcgtccccaaaaaggttgcagcaataatcgacgag
ataggcggagtggaaaggctgaaaaaggctgctagcagggattag

DBGET integrated database retrieval system