KEGG   Archaeoglobus fulgidus DSM 4304: AF_1736Help
Entry
AF_1736           CDS       T00011                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase (mvaA)
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
afu00900  Terpenoid backbone biosynthesis
afu01110  Biosynthesis of secondary metabolites
afu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AF_1736
Enzymes [BR:afu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     AF_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red DUF3759
Motif
Other DBs
NCBI-ProteinID: AAB89513
UniProt: O28538
Position
complement(1558523..1559833)
Genome map
AA seq 436 aa AA seqDB search
MQVLRLDRRHYKSGKIRRAMSSRIPGFYKLSVEERLKKVAEFAGLSDEEVKAVLSQGLPL
DVADRMIENVIGTFELPLGIATNFLIDGKDYLIPMAIEEPSVVAAASNAARMARESGGFT
TDYTGSLMIGQIQVTKLLNPNAAKFEVLRQKDEIIERANECDPMLVNLGGGCKDIEARVI
DTIMGKMLIVHLIVDVKDAMGANAVNTMCEKVAPFIERITGGKVYLRIISNLAAYRLARA
KAVFDKDVIGGEEVVEGIMLAYAFAAADPFRCATHNKGIMNGISALMIATGNDFRAIEAG
AHSYAAIGGYKPLTTYEVDRKGNLVGTIEIPMAVGVIGGATKVNPLAKISLKILGVNTAE
ELARVAAALGLAQNFAALRALATEGIQRGHMELHARNLAIMAGATGDEVDRVVEIMVRDG
KIRLDYAKEVLERLRS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttcttagactcgaccgaagacattataaatcagggaagattagaagagccatg
agttctcgcattcccggattttacaagctcagcgtggaggaaaggctgaagaaggttgct
gaattcgctggattgagcgatgaggaggttaaagcagttttatctcagggtttgcccctc
gacgttgctgacaggatgattgagaacgttatcggcacctttgagcttccgctgggcata
gccaccaatttcctgattgatgggaaggattacctcatcccgatggccattgaggagcca
agtgttgttgccgcagcaagcaacgcagccagaatggcgagggagagcggtggattcacc
acagactacaccggctcgctcatgattggccagattcaggttacaaagcttctcaaccca
aatgcggcgaaatttgaggttctcaggcaaaaggatgaaattatagagagggccaacgaa
tgcgacccgatgctcgtaaacctcggagggggctgcaaggatatagaggcgagagtcatt
gacaccataatggggaagatgctcatagtccacttaattgttgatgtaaaggatgccatg
ggggcaaatgcggtaaacacgatgtgcgagaaggttgctcccttcattgagagaatcact
ggagggaaagtttatctccgcatcatctcgaaccttgcagcctacaggctggcgagggcg
aaggctgtttttgacaaagatgttatcggcggagaggaggttgttgaggggatcatgctc
gcctacgcctttgcagcagctgatcccttcagatgtgccacgcacaacaagggaatcatg
aacggcatctcagccttgatgattgcaacgggcaacgacttcagggctattgaggctgga
gcccacagctacgctgctattggcggctataaacccctcactacctacgaggttgacagg
aaggggaatctggttggaacgatagagattccaatggctgtgggggtgattgggggggca
acgaaggtcaatccgctggcaaaaatctcgctgaagattcttggagtaaacactgccgag
gagctggcgagagtagctgcagctctcggccttgctcagaactttgcagctttaagggct
ttggcaactgaaggaatacagagggggcacatggagcttcacgccagaaacctcgccata
atggccggtgcaacaggagatgaggttgacagggttgttgagataatggtcagggacgga
aagataaggctggactacgccaaggaggttctggagaggttaagaagctga

DBGET integrated database retrieval system