KEGG   Archaeoglobus fulgidus DSM 4304: AF_1779Help
Entry
AF_1779           CDS       T00011                                 

Definition
(GenBank) 2-hydroxyacid dehydrogenase, putative
Organism
afu  Archaeoglobus fulgidus DSM 4304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh IlvN AdoHcyase_NAD NAD_binding_2 TrkA_N F420_oxidored Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AAB89467
UniProt: O28495
Position
1598544..1599515
Genome map
AA seq 323 aa AA seqDB search
MVKVVSFSPIAEPLLKGLIGSVYSGEVEVVVIGEYDERRILEAVRDADIVIGDYTFKIPI
TEEMMRAMEKVKLIQQPSTGYNNIDVEAAKKLSITVANVGGVNALSVAEHTVMFALALLR
RLIYAHNSVLSGRWEQDEMANLGVYELHGKTWGIIGMGAQGREVTKRLQGWGVKIIYHDV
RRAEDIEEYGVEFRDFDALLREADIVSLHVPLTEETRGMIGERELKMMKNSAILINVARG
EVVDENALVRAIKERWIAGAALDVFAKEPPEGSELLELKSHNVIFTPHIAGATNEARLRI
IREAMENIGRALRGEEVKHVVSR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagttgtaagtttttctccaatcgccgagcccctgctgaaggggctgattggc
tcagtctattccggagaagttgaggttgttgttataggtgaatacgacgagcgacgaatt
ctcgaagcggtgagggatgcggatattgttataggggactacaccttcaaaataccgatt
actgaagagatgatgagagctatggagaaagtcaagctcattcagcagccctcgactgga
tacaacaacatcgacgtagaggctgcaaagaagctgagcataaccgttgcaaacgttggg
ggagtaaacgccttgagtgttgcggagcatacggtaatgttcgctctcgctttgctcagg
aggctaatctatgcccacaacagcgttttaagcggtaggtgggagcaggatgagatggca
aacctcggagtttacgagcttcacggcaaaacgtggggcatcatcggtatgggggcccag
ggcagggaggttaccaaaagacttcagggctggggtgtcaaaatcatctaccacgacgtg
aggagggctgaggacatcgaagagtatggagtggagttcagagatttcgatgcgctgctc
agagaggcggacatcgtcagccttcacgttccacttacggaggaaacgaggggtatgata
ggcgaaagagagctgaaaatgatgaagaactctgcaattctgataaacgttgcgagaggg
gaagttgttgacgagaatgctcttgtaagggccataaaggagaggtggattgcaggagcc
gctctcgacgtcttcgccaaggagccccctgaggggagcgagctgcttgagcttaagagc
cacaacgtcattttcacgccccacatagccggagcgacgaatgaggcgaggctcaggata
ataagggaggcgatggagaacattggaagggcgctgaggggagaggaggttaagcacgtc
gttagcaggtga

DBGET integrated database retrieval system