KEGG   Archaeoglobus fulgidus DSM 4304: AF_2059Help
Entry
AF_2059           CDS       T00011                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Brite
KEGG Orthology (KO) [BR:afu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:afu03016]
    AF_2059
Enzymes [BR:afu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     AF_2059
Transfer RNA biogenesis [BR:afu03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    AF_2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-ProteinID: AAB89192
UniProt: O28220
Structure
PDB: 

Position
complement(1855891..1856481)
Genome map
AA seq 196 aa AA seqDB search
MMWEQFKKEKLRGYLEAKNQRKVDFDIVELLDLINSFDDFVTLSSCSGRIAVVDLEKPGD
KASSLFLGKWHEGVEVSEVAEAALRSRKVAWLIQYPPIIHVACRNIGAAKLLMNAANTAG
FRRSGVISLSNYVVEIASLERIELPVAEKGLMLVDDAYLSYVVRWANEKLLKGKEKLGRL
QEALESLQRENAYCSD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtgggagcaatttaagaaggaaaagctcagaggttacctcgaggcaaagaatcag
aggaaggtcgattttgatatagttgagcttctcgacctgatcaactcttttgatgacttc
gtaactctttcaagctgcagtgggagaatagcagtcgtcgaccttgagaagcctggagac
aaagcaagctccctttttctgggcaagtggcatgaaggcgtggaagtcagcgaagtagca
gaggcagcgttgaggagcagaaaagttgcctggctaattcagtacccgccaatcattcac
gttgcttgcaggaatattggggctgcgaagctgctcatgaatgcggcaaataccgccggt
ttcagaagaagtggtgttatttctcttagcaattacgttgttgaaatagcctctctcgaa
agaattgagcttccagttgctgagaagggcctaatgctcgtcgatgacgcctatctatcc
tatgttgttaggtgggcgaacgagaagcttctcaagggaaaggaaaaattgggaaggctg
caagaagctttagagtctcttcagcgtgaaaacgcctattgcagcgattag

DBGET integrated database retrieval system