KEGG   Aspergillus flavus: AFLA_005900Help
Entry
AFLA_005900       CDS       T01090                                 

Definition
(RefSeq) protein kinase, putative
  KO
K00916  CTD kinase subunit alpha [EC:2.7.11.22 2.7.11.23]
Organism
afv  Aspergillus flavus
Brite
KEGG Orthology (KO) [BR:afv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:afv01001]
    AFLA_005900
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:afv03021]
    AFLA_005900
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     AFLA_005900
    2.7.11.23  [RNA-polymerase]-subunit kinase
     AFLA_005900
Protein kinases [BR:afv01001]
 Serine/threonine kinases: CMGC group
  CDK family
   AFLA_005900
Transcription machinery [BR:afv03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    CTDK-I complex
     AFLA_005900
  RNA polymerase I system
     AFLA_005900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 7913248
NCBI-ProteinID: XP_002382790
UniProt: B8NRB5
Position
Unknown
AA seq 583 aa AA seqDB search
MGLDQGDITIRPSGQDHPMGEEKPESEIDDAQKMPPTNIGQPDTSATPNKGGKISFAFKA
KTTPAPAPKPVPDLAQRMLAREPPPRVAEPPRNRMANGPPPKFKPEPRFDRRDRDRERER
DRHRERDRDRGRNDRRDFRDPRGFRDPRDRREGRRDDHRFDHRHDRRRGDRRQDFRPERR
RDRSPEPKKQPKVLVRPKPRPTIPEEFAKSDSVYYRKPGNESVIGAGTYGKVFKAIHVYT
QRKVALKKIRMEGEKDGFPVTAVREIKLLQHLRNDNVVSLLEVMVERNECFMVFEYLSHD
LTGLINHPTFTLTAAHKKDLAKQMFEGLSYLHHRGVLHRDIKAANILISNRGQLKYADFG
LARFFSKSRQLDYTNRVITIWYRPPELLLGETRYGPAVDVWSAACVYVEMFTKKAVFPGE
GGEISQMEKLYNCLGTPTRAEWPDIVEMPWFELMRPTERKRRVFEEVYGQILTPAALDLV
SQIFRYDPTARPNAEEILAHPYFAEEEPRPQQAIELENIEGDWHEFESKALRKEKDREAR
RAEYQRDKEKRKAGTSAPPSERETKRTKQDAEDSQSSAQPTEQ
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttgaccagggtgatatcactatcagacctagcggccaagatcacccgatgggt
gaggaaaagccagagtcggagatcgacgatgcccagaaaatgccacctacgaatataggg
cagcctgatacctctgcgactccaaataagggtggcaaaatcagttttgcattcaaagcg
aagacaactccagcccctgctccgaaacccgttcccgatctggcacaaagaatgctggcc
cgagaaccacctccccgggttgccgagcctcctcgtaataggatggcgaatggtccgcct
cccaaattcaagcctgaaccacgctttgatcgtcgtgatcgcgaccgtgagagagaaaga
gaccgccatcgtgaaagggatcgcgacagggggcggaatgatcggcgcgatttccgggac
ccccgcgggttccgtgatcctagggataggcgcgaaggtcggagggatgatcatcgcttt
gatcatcgacatgacaggagaagaggtgaccgacgacaggatttccgtcctgaacgccgc
cgggatcgctctccagaacccaagaaacaacctaaagttctggtacgaccgaaaccacgt
cccaccatccctgaagaattcgctaaatcggactctgtttattaccgaaaacctggaaat
gaatctgtcattggagctggcacatatggaaaggtcttcaaagcaatccacgtgtatacc
cagagaaaggtggcattgaagaagatacgaatggagggcgagaaagatgggttccctgtc
acagctgtgcgcgagatcaagttgctgcaacacctccgcaacgataatgttgtgagcttg
ctggaagtcatggtagagaggaacgagtgctttatggtgtttgaatatctctcccatgac
cttaccggtctcatcaatcacccgactttcacacttacggcagcccataaaaaggatctg
gcaaagcagatgttcgaaggattgagctaccttcaccatcgtggagtgctgcatcgcgac
atcaaggccgccaatatccttataagcaaccgtggacagctaaaatacgccgacttcggt
ttggccagattcttttcaaagagtcgacaacttgattacacaaatcgtgttatcaccata
tggtaccgaccgccggagcttctcctgggtgaaaccaggtacggaccagcagttgacgtt
tggagtgcggcttgcgtgtacgttgagatgttcacaaagaaagccgttttccccggcgag
gggggcgagatcagccaaatggagaagctctacaattgccttgggaccccgacacgagca
gagtggccagacattgttgagatgccttggtttgagttgatgcggccgactgagcgaaag
agaagggtctttgaggaggtgtatgggcaaatattaaccccagcagctctagacttggtt
tctcaaatattccgttacgacccgactgcacggccaaatgctgaggagatacttgcacat
ccgtactttgcggaggaggagcctaggcctcaacaagccattgagctggagaacattgag
ggtgattggcatgaatttgaatccaaagccctccgcaaagagaaggatagggaagctcgc
cgcgctgagtatcagagagacaaagagaaacggaaggctggtacttcagctccccccagc
gagagagaaacgaaacgtaccaagcaagacgccgaggactcgcaatcttcagcacagccc
acagaacaatag

DBGET integrated database retrieval system