KEGG   Aspergillus flavus: AFLA_007870Help
Entry
AFLA_007870       CDS       T01090                                 

Definition
(RefSeq) phosphatidylserine decarboxylase, putative
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
afv  Aspergillus flavus
Pathway
afv00564  Glycerophospholipid metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
Module
afv_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AFLA_007870
Enzymes [BR:afv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AFLA_007870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PSDC PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 7920193
NCBI-ProteinID: XP_002385033
UniProt: B8NXG8
Position
Unknown
AA seq 459 aa AA seqDB search
MTYKWTWSAILRTLLLLLCVRDAVGGSEIPRLHRAQRPGLWLPKDYRIQQEWTKKIARDT
IANPKPLHPAVQDLKDLIEGDSRIYLLANGMYDDIPANFTDPSGQPVVRSYTDMLSIMNH
LLTIAPPWSEHENQVGLVGLPMHALLDWPMGTFHGHGFFLDPAVNAILKRVLDVWKDYLQ
SPASAEVLNNSTTGWFSPAAIKQLTAVANVDGSSYAFDELFVCDPSEKHYNFTSWDGFFT
RAFRSERRPVAEPHNDSVIANVCESLPFAIAQNVKRRDRFWVKGQPYSVEDMLGKDELSE
HFVGGTIYQAYLSSLSYHRWHAPVTGTIVKVAKFNGTYFSEPLFASMEIYGAWPKAPRYS
QGYLSAVAARAVIYIQADNPAIGLMAVVEVGMSEVSSCEVTVKEGQRVVKGDEMGMFHFG
GSTHCLLFGKGVKVSGFPEPGSRTDNVPVRSRLAVVEEL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacatataaatggacgtggtctgcaattcttcgaaccctgctgctcctattatgtgtt
agggatgctgtgggcggatctgagatcccacgtctccatcgggcacagagaccaggtctc
tggctcccgaaagactaccgcatccaacaagaatggaccaaaaagatagccagagacaca
atagcgaatcccaaaccactccaccccgctgtccaagatctgaaggacttgatagagggc
gactcgcggatctatctcctcgccaatggaatgtacgacgatataccagcgaacttcact
gatcccagcggccagcccgtggtgcgcagctacacggacatgctaagtatcatgaaccat
ctactcaccatcgcgccgccatggagcgaacacgagaaccaggtcggactggtcggacta
cccatgcatgcgctgctagactggccaatggggacgtttcacggccatgggttcttcctc
gaccctgcggtcaatgccatcctgaaacgcgtcttggatgtctggaaggattatctccag
tcccccgcatcagcggaggttcttaataattcgaccacaggatggttcagtccagcagct
attaaacagctcactgctgttgcgaatgtggacgggtcatcatacgcattcgatgagctc
ttcgtctgcgatccgagcgagaaacattacaacttcacatcctgggatgggttcttcaca
cgagcgttccgatcagagcgacgcccagtcgccgagcctcacaatgactcggtgatcgca
aacgtatgtgaatcactaccattcgcaatagcccagaatgtcaaacgacgagatcgattc
tgggtgaaaggtcaaccatactcggtcgaggatatgctcggtaaagacgaactaagtgag
catttcgtcggtggaacaatctatcaagcctatctcagttccctgagctaccaccgatgg
catgcccccgtcacaggaaccatagtcaaggtggccaagttcaatgggacttatttctcc
gagccattgtttgcttccatggagatatatggggcctggccgaaagcgccgcggtactca
cagggatacctgtcggctgtggcggcgagggcagttatttatattcaggcggataacccg
gctattggtctcatggcagtcgtcgaggtgggtatgtcagaagtgtcgagctgtgaggtt
acggttaaggaggggcagagggtggtgaagggggatgagatggggatgtttcatttcggc
ggatcgacacactgtttgctctttggaaagggcgttaaagtgtcgggattcccagagccg
gggtcgagaacggataatgtgccagtgcgaagtcggttggcggttgttgaggagctgtaa

DBGET integrated database retrieval system