KEGG   Aspergillus flavus: AFLA_016560Help
Entry
AFLA_016560       CDS       T01090                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
afv  Aspergillus flavus
Pathway
afv00450  Selenocompound metabolism
afv00970  Aminoacyl-tRNA biosynthesis
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AFLA_016560
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AFLA_016560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:afv01007]
    AFLA_016560
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:afv03016]
    AFLA_016560
Enzymes [BR:afv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AFLA_016560
Amino acid related enzymes [BR:afv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AFLA_016560
Transfer RNA biogenesis [BR:afv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AFLA_016560
 Prokaryotic type
   Other AARSs
    AFLA_016560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g Anticodon_1
Motif
Other DBs
NCBI-GeneID: 7915362
NCBI-ProteinID: XP_002375676
UniProt: B8N672
Position
Unknown
AA seq 625 aa AA seqDB search
MTEQNKPILPESGKRNFLVTSALPYVNNVPHLGNLIGSTLSADVFARYGRGRGANTLYVC
GTDEYGTTSEARAIQENMTTKELCDKYYALHAEVYKWFNISFDIFGRTTTELQTKITQDI
FLKLHDNGFLSEHVTTQLYCEEHKSFLADRFIQGECPHCKYIDAYGDQCDLCGQLLDPLD
LIKPRCKLDGATPVKRDTKHIFLKLDKLQPEIQAFFDESSAKGGWSQNGKDITSSWLTKG
LQERSITRDIKWGTQVPLPGYEEKVIYSWFDACIGYVSITANYTDQWEKWWRNPEDVELY
QFIGKDNVAYHSVMFPGTEIGTREKWLKVHHLSTTEYLTYEGGKFSKSRGIGVFGDSAKK
TGIPADVWRYYLLSHRPETGDSEFNWDLFISSNNNILLKNLGNFVSRVVKFVNSKNYDNI
VPDYTAYTEPAFDAWKEEVNELLTQYIQQLDAVKIRAAIDTVLTISQKGNLFLQSNSLDN
KLAENEPAKCAAVIGLALNLIHLLSALLAPYMPETAASINEILRTEAIQIPDRWNADTVK
PNHEIGKAKYLFSNIKPEKANEWRDMFGDEEAKKVKEEEAKKKAAKKAEKLAKKEKKKEQ
KEKEAASADGVSEISQSAEKLNIQQ
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaaaataaacccattctccccgaatccgggaagcgcaatttcctcgtcact
agcgctctgccatacgtgaacaatgttcctcatctgggcaatttgataggttcgactctg
tcggctgatgtctttgccagatatggtcgtggccgtggtgccaacaccctctatgtctgc
ggtaccgatgagtacggcacgacgtccgaagcgagagccatccaagaaaacatgaccacc
aaggaactttgcgacaaatattatgccctccatgctgaagtttacaaatggttcaacatc
agctttgatatcttcggccgcacaaccaccgagcttcagaccaagatcacccaggatatt
ttccttaagcttcacgataatggcttcttgtcggagcacgtaacaacacaattatactgt
gaggagcacaagtcgttcttggcagaccgctttatccagggtgaatgcccacactgcaag
tatatcgatgcctatggtgatcaatgcgacctgtgcggtcagcttctggacccattggat
cttatcaagcctcgctgcaagctcgacggtgccacccccgtgaagagggatacgaaacat
atcttcctgaagttggacaagttacaacccgagatccaggcatttttcgacgagtcttcg
gcgaagggaggatggtcacagaacggaaaggacatcacctcatcctggttgacgaaggga
ttgcaagagcgcagcattactagagatattaagtggggtactcaggtgcctctgcccggc
tacgaggagaaggtcatctactcttggttcgatgcttgcattggttatgtttctatcacc
gcaaactacaccgaccagtgggagaagtggtggcgcaacccggaggatgtcgagctttat
caattcattggaaaggataacgttgcctaccactccgtcatgttccccggtactgaaatc
ggtactcgggagaagtggctcaaggtccaccacctctctaccactgaatacttgacttat
gagggtggcaagttctccaagtctcgcggcatcggtgtgttcggagactcggccaagaag
actggcatccccgccgacgtatggcgttactacctgctctctcaccgtcccgaaactggc
gacagcgagttcaactgggatctctttatcagctcaaacaacaacattctcctcaagaac
ttgggtaacttcgtcagccgtgttgtgaagttcgttaactccaagaactacgacaacatc
gttcccgactacaccgcctacactgagcctgccttcgacgcctggaaggaggaagtcaac
gaacttctcacccagtacatccagcaactcgatgccgtcaagatccgtgccgccattgac
accgtcctcaccatctcccagaagggtaacctgttcctccagtccaacagcctcgataac
aagctcgccgagaatgaaccggccaagtgcgccgctgtgatcggcctcgccctcaacctc
atccacctcctgtccgccctcctcgccccctacatgcccgaaaccgccgccagcatcaac
gagatcctccgtaccgaggctatccagatccctgatcgctggaacgccgacaccgtcaag
cccaaccacgagattggcaaggccaagtacctgttcagcaacattaagcctgagaaggcc
aacgagtggcgtgacatgttcggtgacgaggaggccaagaaggtcaaggaggaagaagcc
aagaagaaggccgctaagaaggctgagaaattggccaagaaggagaagaagaaggagcag
aaggagaaggaggctgcttccgccgacggagtgtcggagatctctcagtccgctgagaaa
ctgaacattcaacagtag

DBGET integrated database retrieval system