KEGG   Aspergillus flavus: AFLA_016930Help
Entry
AFLA_016930       CDS       T01090                                 

Definition
(RefSeq) O-methyltransferase, putative
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
afv  Aspergillus flavus
Pathway
afv00350  Tyrosine metabolism
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFLA_016930
Enzymes [BR:afv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     AFLA_016930
Exosome [BR:afv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AFLA_016930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_24 Methyltransf_3 Nha1_C Peptidase_S49_N SR-25 Med19
Motif
Other DBs
NCBI-GeneID: 7918791
NCBI-ProteinID: XP_002375713
UniProt: B8N6U0
Position
Unknown
AA seq 331 aa AA seqDB search
MKILESSSGLLNSLCCSTQRPRLRVTGRDGAMAAGFKRVPGTVGPKKKKKRKKERKKKKK
KERKKEKEKERKEKRAVFCPGTPGTIEAKARALHEHIFSKPEDTYAGKPWDVVKAINDFA
DESRMMTFKNAKIEASRQQIAKIQPAPKTFIEFGGYVGASAIAWGAILRELNNTDSAVDV
NVYTFELSPVNAGIARDLIRLAGLENTVHVLEGPAADSLKRLFEEGKLKEAGVDVAFFDH
WEQFYLPDLQLCEDLGLFRKGSKVIADNTDFPGAPAYLEYVKSGGRQGGSYRYETESIET
ASNCGPVSSPYLYLNICVVVGTDCFSEHRRG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattggagtcgtcatctggcttactcaatagcctatgctgctcaacacaacga
cctcgtctgcgggtaacagggagggacggggcaatggctgctggctttaagagggtccca
ggaacggttggacctaaaaaaaaaaaaaaaagaaagaaagaaagaaagaaaaagaaaaag
aaagaaagaaagaaagaaaaagaaaaagaaagaaaagaaaagcgggcagttttctgtcct
ggcacacctggaaccatcgaagccaaggccagggctctccatgagcacatcttctctaag
ccagaggatacttatgccggcaagccctgggatgtggtgaaagctatcaacgactttgcg
gacgaaagccgcatgatgaccttcaagaatgccaagatcgaagcttccaggcagcaaata
gcaaagatccagccagcccctaagacctttatcgaatttggtggatatgttggggcctca
gccatcgcctggggtgctattctgcgtgaactcaacaatacagatagtgcagttgacgtc
aatgtatacacatttgagctgagcccggtcaacgctggtattgcacgggatctcattcgg
ctagccggcttggagaacaccgtgcatgttctcgaaggaccagctgcagactcgctgaag
cggttattcgaagaggggaagttgaaggaggcgggcgtggatgtagcctttttcgaccac
tgggagcagttctacctcccggatctgcagctttgcgaggatctaggcttgttcaggaag
ggctccaaagtcattgctgataacacggatttcccgggtgcacctgcctaccttgagtat
gtgaaatctggtgggcggcaaggcgggtcttatcgttatgagactgagtctattgagact
gcctcgaactgtggtcctgtgagttccccctacctatacctgaatatttgcgtggttgtt
ggtactgattgtttttcagagcatcgtcgaggttag

DBGET integrated database retrieval system