KEGG   Aspergillus flavus: AFLA_018800
Entry
AFLA_018800       CDS       T01090                                 

Definition
(RefSeq) nitrite reductase NiiA
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
afv  Aspergillus flavus
Pathway
afv00910  Nitrogen metabolism
afv01100  Metabolic pathways
Module
afv_M00531  Assimilatory nitrate reduction, nitrate => ammonia
afv_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AFLA_018800
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     AFLA_018800
SSDB
Motif
Pfam: NIR_SIR Pyr_redox_2 Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Pyr_redox Rubredoxin_C FAD_binding_2
Other DBs
NCBI-GeneID: 7912123
NCBI-ProteinID: XP_002375900
UniProt: B8N6B6
Position
Unknown
AA seq 885 aa
MTDLEDFGKVKLIDRNKWVLARQLDGDAGTLVTRKIRELGLDVMHQKRVAKIKTDDNNNV
TGIVFEDGEEIDCCCIGVRPRDELGTTAGIQCASRGGFVINESLQTSIPEIYAIGECASW
ENQTFGIIAPGIEMADVLAFNLTNPDKEPKSFRRPDLSTKLKLLGVDVASFGDFFADRDG
PKFLPGRRPSVATIPRVKDTTEKESPVKALTYKDPFGGVYKKYLFTMDGKYLLGGMMIGD
TKDYIKLNQMVKSQKELEVPPSQFILGAQNGGEENGDDLADDTQVCSCHNVTKGDIVESV
KSGTCKSIGEVKSCTKAGTGCGGCMPLVQSIFNKTMLDMGQEVSNNLCVHIPHSRADLYN
IVAIKQLKTFEDIMKAVGRNPDSLGCELCKPAIASILSSLFNGHIMDHEYHELQETNDRF
LANIQRNGTFSVVPRVPGGEITADKLIAIGQVAKKYNLYCKITGGQRIDMFGAKKQDLLD
IWTELVNAGMESGHAYAKSLRTIKSCVGTTWCRFGIGDSVGMAIRLEERYKSVRSPHKLK
GAVSGCVRECAEAQNKDFGLISTEKGFNIFVGGNGGAKPRHSELLAKDVPPDMVIPIIDR
YLIFYIRTADKLQRTARWIENLPGGINYLREVVIDDKLGICAEMEQQMQELVDSYFCEWT
ETIRNPKRRKYFQQFANTDETVDTVELVKERDQERPTYWPSEGAKEDFKGHQWSALSWQP
IIKADHFSDGPPAISSANVKRGDTQLAIFKVKGKYYATQQMCPHKRAFVLSDGLIGDDDA
GKYWVSCPYHKRNFELNGEQAGRCSNDEAMNIATFPVEERDDGWIYLKLPPVEELDSVLG
TEKWKVKKGEAPDPFQKCDKKYKGTRGKKVGDRPSPTKQSKTIDW
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgacggatctagaagatttcggcaaggtcaagctcattgaccgcaacaagtgggtacta
gcaagacaactagacggcgatgccggtaccctagtgacgcggaaaatcagagaactgggc
ttggatgtgatgcaccagaagcgagtagcgaaaattaagacggatgacaacaacaatgtc
acgggtatcgtctttgaggatggggaagaaatagattgctgctgcatcggagtacgacct
agagacgagttggggacgactgctggtattcagtgcgcttcacggggtgggtttgttatc
aatgaaagtctgcaaacttcgattcccgagatttacgctatcggagagtgtgcaagctgg
gaaaaccagacgtttggtattattgcacctggcattgaaatggcagatgtgctagcgttc
aatttgaccaatcccgataaggaaccaaagagcttcagaagaccggatttaagcactaag
ctgaagctcttgggagtggatgtcgccagttttggtgacttttttgcggatcgcgatggc
cccaagttcttgccaggccgtcgaccatcagtcgcaaccattccgcgggtgaaagacacg
acggaaaaggagtcaccagtgaaggctctcacgtacaaggatccttttggtggtgtctat
aagaagtatctattcactatggacggcaaatacctacttggaggaatgatgatcggtgat
acaaaggactatatcaaactgaaccaaatggtgaagagccaaaaagagctcgaagttcct
ccgagccagttcattctgggagctcaaaatggtggggaagaaaacggtgacgacctagcc
gacgatacccaagtttgctcgtgtcacaacgttaccaaaggtgacatcgtcgaaagtgtc
aagagtggcacatgcaagtcaattggagaggtaaagtcatgcacaaaggcaggcactggc
tgtggaggctgtatgccgttagtgcaatcaattttcaataagaccatgcttgatatgggt
caggaggtttcgaataacttatgcgtgcatattccacattcacgcgctgacctctacaat
atcgtcgcaatcaaacaactgaaaacattcgaagacatcatgaaggcagtcggaagaaac
cccgattctcttgggtgcgagctatgcaagcctgccatagcgtcaatcctttcgagtctc
ttcaatgggcacatcatggaccacgaataccatgagttgcaagaaacgaatgacagattc
ctcgctaacatccaacgcaatggaactttctctgtggtccctcgagttcccggtggtgaa
atcactgcagacaagcttattgctatcggacaggtggccaagaaatataacctttactgc
aagatcacaggtggccagcgtatcgacatgtttggagccaagaaacaggatctgcttgat
atctggacagaattagtcaatgccggcatggaaagtggtcacgcttatgccaaatctctc
cggacaatcaagagctgcgttgggactacctggtgtcgtttcggtatcggagacagtgtc
ggaatggctattagactcgaggaacgctacaaaagtgttcgatctcctcacaagctcaag
ggcgccgtgtccggttgcgtgagagaatgtgctgaagcacaaaacaaagactttggtttg
atctctacagaaaaagggttcaatatcttcgtaggcgggaatggcggcgcgaagcctaga
cattcagaactactcgccaaggatgtgccaccagatatggtcattccaatcattgatcgc
tatctcatcttctacattcgaacagcagataagctgcagcgaactgctcggtggatcgag
aatctccctggggggatcaattacctccgggaagtcgtcatcgacgacaaactgggaatc
tgcgctgagatggagcagcaaatgcaggagttggtagacagctatttctgcgagtggacc
gagactatccgcaacccgaagcgccgcaaatacttccagcagtttgccaacaccgatgaa
acggttgacacggtggaacttgtcaaagaacgtgatcaagagcggcccacctactggccg
agcgagggcgcaaaggaggacttcaagggacatcagtggtcggctctctcatggcagccg
atcatcaaagctgatcacttctccgatggacctcctgcgatctcttccgccaatgtcaag
cggggcgatactcagctggcaatcttcaaggtcaagggcaagtactacgcaacgcaacag
atgtgtcctcacaagcgtgcctttgtcctgtccgatggcctgattggcgacgatgacgcc
ggcaaatactgggtatcctgtccatatcacaagcgtaatttcgagctcaatggcgagcaa
gccggccgttgttcaaacgatgaggctatgaatatcgcaactttcccggttgaggaacgg
gacgatggctggatctacttgaagttacctcccgttgaggagctggactctgtgctgggg
acagaaaaatggaaggtaaagaaaggagaagcaccagatccattccagaagtgtgataag
aagtataaggggacgagaggcaagaaggtgggtgatagacccagcccgaccaaacaatct
aagacgattgactggtaa

DBGET integrated database retrieval system