KEGG   Aspergillus flavus: AFLA_019980Help
Entry
AFLA_019980       CDS       T01090                                 

Definition
(RefSeq) beta-galactosidase, putative
Organism
afv  Aspergillus flavus
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 BetaGal_dom2 BetaGal_dom4_5 BetaGal_dom3
Motif
Other DBs
NCBI-GeneID: 7914956
NCBI-ProteinID: XP_002376018
UniProt: B8N765
Position
Unknown
AA seq 981 aa AA seqDB search
MINDERIMIFSGEFHPFRLPVPGLWLDVFQKIKSMGFNGVSFYTDWGLLEGNPENVMVGD
NGINNDTDIWNLDEFFAAASEAGIYLIARPGPYINAETSAGGIPGWVLRIKGAIRSMSPD
YVGAIKNYMSTVGKIIADAQITRGGPVIMVQPENEYTTWPGLTEEEFPSQMNREVMAFMA
EELRAAGVEVPMAMNDNEVEGYFAPGTGLGEVDIYGIDAYPMRYDCAHPDVWPTYRFPYD
WNILHEEQSPTTPFTIMEFQGGSGGGWGGVTEEGCAMLVNQEASRVVYKNNYSFGVKIFN
IYMTYGGTNWGNLGYHGGYTSYDYGASIAEDRTLTREKYSEQKLQANFFKVSPAYLTATP
GTGQNGSYTDNPRIAVTPLVGNGTKTNFYVVRHADFTFTGNARYRMTVSTSIGNVTLPQL
HNTTLSLNGRDSKLHVTDYDVGGINMIYSSAEVLTWARALSSTRVLVLYGGEDEVHEVAF
SRALSEPVILDGPTSGIIIEQQQAAWVIQWRVTATPRVIQIGDLELHLLWRNDAYDYWVM
EVPAAEPIGNYSSPSKDLIIVKAGYLVRSASIQDNHLVLSGDVNATTTVEVISTPQEVRG
IVFNNQSLNTILSSRGKLQGSVPYHPPTISVPSLYDLEWRYLDSLPEIDPLYDDKAWTVL
NQSWSNNPRNLTTPTSLYALDYGYHTGSLLYRGYFIANGQESSLFLNISGGAGFGYSIWL
NDNYLDSWAGSSDSSFYAQNISLVPTTNNAGLSMGKPYTISILIDHMGYDEEAPGTDAIK
FPRGILDYSLSGHEHQSDLRWKMTGNLGGEQYHDLIRGPLNEGAMFAERQGYHLPQPPSD
TWETRSPFTKGIEKPGVGFFTTSFPLNLPKGYDIPLRFVFAFNGSTNVVHTRNYRCQLYV
NGFQFGKFVNNLGPQTDFPVPEGILNYNGNNHIAVTLWGLDGGAVLGPEGLQLVASRPIW
SGYRKPTAVEWPGYVKRRGAY
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgattaacgatgaacgcatcatgatcttttcgggcgaattccaccctttccgcctccct
gttcccggattatggctcgatgtcttccaaaagatcaaaagcatgggtttcaatggcgtc
tccttctacaccgactggggccttttggaaggcaaccctgaaaatgttatggtcggcgac
aacggtattaacaatgacactgatatctggaatctggatgagttctttgctgctgcatct
gaagctgggatctatctcatcgcgcgacccggtccatatatcaatgctgaaacttctgct
gggggcattcctggatgggtcctacgtatcaaaggggccattcgatcaatgagtccagat
tatgtgggtgctatcaagaactatatgtcgacagttggaaaaatcattgccgatgcacag
atcacgagagggggcccggttatcatggtccagccggagaatgagtatactacctggcca
ggactgacagaggaggaatttccatcgcagatgaatcgagaagttatggcgttcatggcg
gaggagttacgtgctgccggggtggaagtacccatggcaatgaacgacaatgaagtagaa
ggatactttgcaccaggaactggactgggtgaggtggatatctatggaatcgatgcttac
ccaatgcggtatgattgtgcacatcccgatgtttggccaacgtacagatttccttacgac
tggaacatcctgcatgaagagcagagtcccacgacaccgtttacaattatggagtttcaa
ggagggtcaggtggggggtggggaggagtcacggaggaagggtgtgcaatgctggtcaat
caagaagcctctcgcgtggtatacaagaacaactacagctttggtgtcaagatcttcaac
atctacatgacgtatggtggtaccaattggggaaatctaggataccacggcggttatacc
tcgtatgactacggtgcctccatcgccgaggaccgaactctcacacgcgaaaagtacagc
gaacagaaactgcaagccaacttcttcaaagtatcgccggcctatctaacggcgactccg
gggactggccagaatgggtcgtacacagacaacccgcgaatcgctgtcactccactggtt
ggaaatggcaccaaaacgaacttctacgtcgttagacatgcggatttcacgttcacgggc
aatgcaagatacagaatgaccgtgtcgaccagtatcggcaacgtcactctcccacagcta
cataatacaacattatcattgaacggacgtgattccaagttacatgtgacagattatgat
gttggtggcatcaacatgatctattcctctgcagaagtattgacttgggcacgcgctctt
agctcaacccgggtactcgttctatatgggggagaggatgaagtgcatgaagttgccttc
tcgcgggccttatccgaaccagtcattctcgacggtccaacttctggtatcataatcgaa
caacaacaggctgcatgggtcattcaatggagagtaaccgctacgcctagggtgatccaa
attggagatctcgagcttcaccttctatggcgtaatgatgcctacgattactgggtaatg
gaagtaccagctgcggaacctataggcaactatagttcaccatcaaaggatctcatcatt
gtgaaagcagggtacctcgttcggagtgcatcaattcaggacaaccacctagttttgagt
ggagacgttaacgcgacaaccactgttgaagtcatatccacaccacaagaagtacgcggt
atagtattcaataatcaatcactcaacactatactttcatccagaggaaagcttcaaggg
agcgttccgtatcatccacccacaatttccgttccgtctctatacgacctcgaatggaga
tatctcgattcccttccggagatagatcccttgtacgatgacaaggcatggacagttctc
aatcaatcctggagcaacaaccctcggaacctcactactccaacctcactttatgcactt
gactacggctaccacactgggtctctcctttaccgagggtactttattgctaacggacag
gagagctcccttttcctaaatatctcgggtggggcgggcttcgggtattccatctggttg
aatgataactatctcgattcttgggcagggagcagcgatagttcattttatgcgcagaac
atctcacttgttcccactactaacaacgcgggcctctctatgggaaagccttacaccatc
agtattttgattgaccacatggggtacgacgaggaggccccaggcacagacgctattaag
ttccctcgcggcatcttggactactccctttctggtcatgagcatcaatccgacctccgc
tggaagatgacgggaaaccttggtggcgagcagtatcacgatctcatccgtggtcctctc
aacgaaggagctatgttcgccgaacgacagggctatcatctaccccaacctccgagcgat
acatgggaaacacgaagtccgtttacgaaagggattgagaagccaggggtcgggttcttc
actacatcctttcccctgaatctgcctaaagggtacgacattccattacggtttgtattc
gcatttaatggctcaacgaacgtcgtacatacgcgcaattatcgctgccagctctatgtt
aatggctttcaatttgggaagtttgtcaataatctcggcccgcaaacagatttccctgtg
cccgagggaattctcaactacaacgggaacaaccatatagcagttacactgtggggcctg
gacggtggagcggtgcttgggccagagggcttacaacttgtggcgtcgcggcctatttgg
tcagggtatcggaaaccaaccgcggtggagtggccaggatatgtgaagagaaggggggca
tactga

DBGET integrated database retrieval system