KEGG   Aspergillus flavus: AFLA_025300Help
Entry
AFLA_025300       CDS       T01090                                 

Definition
(RefSeq) alpha-galactosidase AglB
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
afv  Aspergillus flavus
Pathway
afv00052  Galactose metabolism
afv00561  Glycerolipid metabolism
afv00600  Sphingolipid metabolism
afv00603  Glycosphingolipid biosynthesis - globo and isoglobo series
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AFLA_025300
  Lipid metabolism
   00561 Glycerolipid metabolism
    AFLA_025300
   00600 Sphingolipid metabolism
    AFLA_025300
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    AFLA_025300
Enzymes [BR:afv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AFLA_025300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase Glyco_hydro_10
Motif
Other DBs
NCBI-GeneID: 7909220
NCBI-ProteinID: XP_002374041
UniProt: B8N306
Position
Unknown
AA seq 442 aa AA seqDB search
MQRYISLSVSLSLLSGANALVRPDGVGRLPALGWNTWNAFGCDIDASKVLTAAEETINLG
LKDAGYEYINIDDCWSVKSGRDPNTKRIIPDSAKFPDGISGVASKIHDLGLKVGIYSSAG
TETCAGYPASLGYEKIDAESFAEWGIDYLKYDNCGVPTNWTDTYTHCVPDNSNGSKFPNG
TCPDISNPAPTAYDWSSSNTAQRYNAMRDALLGVNRTILYSLCEWGQADVNTWGNGTGNS
WRTTGDITPDWSRIVEIANENSFLMNYADFWGYPDPDMLEVGNGNLTLEENRAHFALWAA
MKSPLIIGTALDSINEEHLAILKNKPLLSFHQDPVIGRPAYPYKWGYNPDWTFDPAHPAE
YWSGPSSTLGGTLVLMFNSEDSAKHRTAVWSEIPELKDSAEKGSGYRVTDIWTGEDLGCV
KDQYDVELQSHDIAALVVGESC
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgttacatttctttatccgtgtcgctgtctttgctttccggggctaatgctctg
gtacgccctgatggtgtgggaagactacccgcgttgggttggaacacctggaatgcattt
ggatgtgacatcgatgcctccaaggtcctgactgccgcagaagaaacaataaacctgggc
ttgaaagatgcaggttatgaatacatcaatatcgatgattgctggtccgtcaagagtggc
cgagatcctaatacaaaacgcatcattccggactcggccaagtttccggatggaatctca
ggtgtcgcttctaagattcacgacttgggtctgaaggtcggcatttatagcagcgctggt
acggaaacctgcgctggctatcctgctagtctgggatatgagaaaatagacgccgagagc
tttgctgaatggggcattgattatctgaaatatgacaactgcggcgtacctactaactgg
accgatacatatacccactgtgtgccagacaacagtaatgggtctaagttccccaacggc
acttgtccggatatttctaacccagcaccgacggcgtacgactggagcagctcgaacact
gctcaaagatacaacgctatgcgcgatgccttactgggtgtcaatcggaccattctctat
tcgttgtgtgaatggggccaggcagacgtgaacacatggggcaacgggacaggaaactct
tggagaacaacgggtgatattacacccgactggagccggattgtcgagattgccaacgag
aactcgttcctcatgaactatgccgatttctggggatatccagatcctgacatgttggaa
gtggggaatggaaacctgactctcgaagagaatagagctcactttgctctatgggcagcg
atgaaatcgcctctgatcatcggcactgctctcgactcaatcaatgaggagcaccttgct
attctgaagaataagcccttgctgtccttccatcaagatccggtcatcggtcggcctgcg
tatccttataaatggggatacaacccagactggacattcgatccagcacatccagcggaa
tattggtccggaccatcctcgactctgggtggaaccctggtcttgatgttcaactcggaa
gacagtgccaaacatcggactgccgtgtggagcgagatccctgagctgaaggattccgcc
gagaagggcagtggatatcgggtaactgacatttggacgggtgaagacctgggctgtgtg
aaggatcagtatgacgtggagttgcagagtcatgatattgctgctctggtggtgggagaa
tcatgctga

DBGET integrated database retrieval system