KEGG   Aspergillus flavus: AFLA_030030Help
Entry
AFLA_030030       CDS       T01090                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit EifCa, putative
  KO
K03254  translation initiation factor 3 subunit A
Organism
afv  Aspergillus flavus
Pathway
afv03013  RNA transport
Brite
KEGG Orthology (KO) [BR:afv00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    AFLA_030030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:afv03012]
    AFLA_030030
Translation factors [BR:afv03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    AFLA_030030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 7919369
NCBI-ProteinID: XP_002374513
UniProt: B8N1D8
Position
Unknown
AA seq 1047 aa AA seqDB search
METNAGVFTRLRGRRNLSPWARPPPPSMSFTNMSPPRGRAAAPSCRWNRLCYFSSSCAWI
FARERPPRMDCINIRTSPRTPMWLLSRYADHGRLEVGMVVLKKFIELAEKKVTEAQAKAD
EIQSSLESAAPSSNVEDLEAIETPETILLATVSGEQSRDRTDRAVVTPWLKFLWETYRTV
LEILKNNARLEVMYQTTALQAFQFCLKYTRKTEFRRLCELLRNHVQNAAKYSAQMHAINL
SDPDTLQRHLDTRFQQLNVAVELELWQEAFRSIEDIHTLLSLSKRPAKNVMMANYYEKLA
RIFLVSENYLFHAAAWSRYYNLLRQSAATLAAGQGTKKENPSVTDADMTKAASFVLLSAL
AIPVISTSRSRGALVDVDEVRKNKNTRLTNLLGMAQSPTRAVLFKDALNKGLLKRARPEI
RDLYNILEVDFHPLSICKKITPILKQIGADPEMEKYVVPLQQVILTRLFQQLSQVYESVS
LKFVYELAQFPDPFQVTPAMIEKFIMNGCKKGDLAIRVDHISGVLTFDTDVFSSAKALHS
GSAAGSAESEVGSVQRMQNTPAEIARLQLTRLAKTLHVSCMYVDPSYHEARLQAKQAAQT
RAAAGAAKEHEETLARRVIIDKKKEAATDALQRKQREEETRKRIRTQQLQEAEKQRLLDE
QREREKKRIKDEQDRIREQELKKQIEELKSGVKGIDLSEVDLKDLDANRLRAMKLAQLEK
EKNELNDRIRTTGKRIDHLERAFRREELKHIPADYEAQKKRDMELYEALKAETLKEAEDK
HKEAVALKHRLSRLVPVFNNFRKEVSEKRHEEFERRRKAAERDFEAKKKQRIKEVQDRRR
RERAEREEAERRQKEEEERIKREEEERAAKEEERRRVLAEEKAKREEERKKLDEIALKQK
QREEEAEARRASRKTGFPEPPARAEPERTAPRLNLAPRTGGGPSWRERQAAKEAAGGAAP
EPAKEEPAAQPPRRTGGYVPPHLRGASAAAPAAPPSSGAAPSRYVPPSARDSGSSTPPSR
TQTPATTSEEPKSAGKWVPRWKQQQGQ
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaacgctggtgtttttactcgtcttagagggcgcaggaacttatcgccgtgg
gccaggcccccgccgccctcaatgtccttcacgaacatgtcacctccaagaggacgcgca
gcagccccatcgtgtcgctggaaccggttatgctacttttcgtcgagctgtgcgtggatc
ttcgcaagggaaaggccgccaaggatggattgtatcaatataagaacatcgcccagaaca
ccaatgtggctactatcgaggtacgcggatcatgggagactagaggtgggaatggtcgtc
ctcaagaagttcatcgaactcgccgagaagaaggtgaccgaagcccaagccaaggccgat
gagatccagtcttcgttggaatccgccgccccctcgtccaacgtggaggatttggaagcc
atcgaaacccccgagaccatccttctcgccactgtttctggtgagcagtcccgtgatcgt
accgaccgcgctgtcgtgaccccatggctcaagttcctctgggagacctaccggaccgtt
ctggaaatcttgaagaacaatgctcgtctcgaggttatgtaccagactaccgccctccag
gccttccagttctgcctgaagtacacccgcaagacggaattccgcaggctctgtgagctc
ctccggaaccatgtgcagaacgctgccaagtattctgctcagatgcacgccatcaacctg
agcgatcccgacactcttcagcgccatttggatacccgtttccagcagctgaatgtggcc
gttgagttggaactctggcaggaggctttccgcagcattgaggatattcacactcttctg
agcctcagtaagcgcccggccaagaacgtcatgatggccaactactacgagaagctggct
cgcatcttcctggttagcgagaactaccttttccacgccgctgcctggagccgctactac
aacctcctccgccagtccgctgccaccctcgctgccggtcagggtaccaagaaggagaac
ccttccgtgactgatgccgacatgaccaaggccgcctctttcgtccttctgtctgctctt
gccattcccgtgattagcacctctcgttctcgcggcgccttggtcgatgtggatgaggtc
cgcaagaacaagaacactcgcctcaccaacctcctgggtatggcccagtctcccacccgt
gcagttctcttcaaggatgctctcaacaagggtctgctgaagcgtgctcgccctgaaatc
cgtgacctctacaacatccttgaggtcgacttccaccccctgtccatctgcaagaagatt
acccccatcctcaagcagattggcgctgaccccgagatggagaagtacgttgtacctctg
cagcaggtcattttgacccgtctcttccagcagctgtctcaggtctacgagtccgtttcg
ctgaaattcgtgtacgagctggcccagttccctgatcccttccaggtcactcccgctatg
atcgagaagttcatcatgaacggttgcaagaagggcgatctcgccatccgggtggaccac
atctcgggtgtccttaccttcgacaccgatgtgttctcgtctgctaaggccctgcactct
ggcagcgcggctggatctgcggaaagcgaggtgggctcggtgcagcgcatgcagaacacc
cctgctgagatcgctcgcctgcagctcactcgccttgccaagactctccatgtttcgtgc
atgtatgtcgatccctcgtaccacgaggctcgtctgcaagccaagcaggcggcccagacc
cgcgctgctgccggtgctgccaaggagcatgaggagaccttggctcgccgtgttattatc
gacaagaagaaggaggccgccactgacgctttgcagcgtaagcagagagaggaggagacc
cgcaagcggatccgtacccagcagctccaggaggctgagaagcagcgtctgcttgatgaa
cagcgcgagcgcgagaagaagcgcatcaaggatgagcaggatcgtatccgcgagcaggaa
ctcaagaagcagatcgaggagctgaagagtggagtgaagggcattgacctcagtgaagtt
gatctcaaggacctcgatgctaaccgcctccgcgcgatgaagcttgcccagctcgagaag
gaaaagaacgagctcaacgatcgtattcgcaccactggcaagcgtattgaccatctggag
cgtgctttccgtcgcgaggagttgaaacacattcctgccgactacgaggcacagaagaag
cgtgatatggagctctacgaggccttgaaggccgagaccttgaaggaggccgaggacaag
cacaaggaagctgttgctctcaagcaccgtctcagccgtctggtacctgtgttcaacaac
ttccgcaaggaggtctccgagaagcgtcacgaggagttcgagaggcgtcgcaaggctgcc
gagagagacttcgaggctaagaagaagcaacgtatcaaggaagtgcaggaccgcaggcgc
cgtgagagggctgagcgtgaggaagctgaacgccgccagaaggaggaagaggaacgtatc
aagcgtgaggaagaagagcgtgctgccaaggaggaagagcgcagacgtgttctggctgag
gagaaggctaagcgcgaagaagagagaaagaaacttgatgagattgctcttaaacagaag
cagcgcgaagaggaggccgaagcccgccgtgcttcccggaaaactggtttcccagagccg
cccgctcgtgcagagcctgaacgtactgctcctcgccttaacctggctcctcgcactggt
ggcggacctagctggagagagcgtcaagccgccaaggaggccgccggcggtgctgctcct
gagcctgccaaggaagagcctgctgcccagcctccccgtaggaccggtggctacgtgcct
cctcatctccgcggtgcttctgcagctgcccccgctgctcctccttctagcggcgctgca
ccaagccgctacgtgccccctagtgctcgcgactccggttcctctactcccccctctcgt
acgcaaacccccgctactacttctgaggagcctaagagcgctggaaagtgggtgcctcgg
tggaagcagcaacaaggccagtaa

DBGET integrated database retrieval system