KEGG   Aspergillus flavus: AFLA_036070Help
Entry
AFLA_036070       CDS       T01090                                 

Definition
(RefSeq) maleylacetoacetate isomerase MaiA
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
afv  Aspergillus flavus
Pathway
afv00350  Tyrosine metabolism
afv01100  Metabolic pathways
Module
afv_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AFLA_036070
Enzymes [BR:afv01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     AFLA_036070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 7913512
NCBI-ProteinID: XP_002375117
UniProt: B8N2C2
Position
Unknown
AA seq 233 aa AA seqDB search
MTDETPKITLYTYFRSSSAARLRIALNLKSIPYTSIPVNLLKGEQSSPANRALNPSGTVP
TLVVERPASQGATVTITQSLAALEYLEEITPASSHALLPPVSDPESRAVVRTLCEIIGCD
VQPVTNLKILKRVGPLGFDRETWSKELIEDGFRAYETIVSRTAGVFSVADTVTMADVCLL
PAVWGAQRSGVNLAEYPTIQRIAERLEKEDAVKKAHWRTQDDTPEEFRLKESS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaaactcccaaaatcaccctatacacatatttccgatcctcctccgcagcc
cgtctccgcatcgctctcaacctcaagtcaatcccctacacctccatccctgtaaacctc
ctgaaaggcgagcagtcatcccccgccaaccgcgccctcaacccctccggcaccgttccg
acccttgtggtcgagcgcccggcatcccagggcgcaacggtgaccattacacaatccctc
gccgcgctcgaatatctggaagaaatcaccccggcatcatcccacgctctcctcccaccg
gtctcggacccggagtcccgtgcggtcgttcgcaccctctgcgagatcattggctgcgat
gtgcagccggttacgaacctgaagattttgaagcgagttggcccgctgggattcgatcga
gagacgtggtcaaaggagcttattgaggatgggttccgcgcttatgaaactattgtttca
cggacggcgggtgtattcagtgttgctgatactgtgactatggctgatgtgtgtttgctt
cctgctgtgtggggggcacagcgctctggcgtgaatttggccgagtatcctactatccag
cggattgcggaacggttggagaaggaggatgcggtgaagaaggcgcattggagaactcag
gatgatacacctgaggagtttcgcttgaaggaatcttcgtag

DBGET integrated database retrieval system