KEGG   Aspergillus flavus: AFLA_047140Help
Entry
AFLA_047140       CDS       T01090                                 

Definition
(RefSeq) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
afv  Aspergillus flavus
Pathway
afv01100  Metabolic pathways
Brite
Enzymes [BR:afv01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AFLA_047140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase
Motif
Other DBs
NCBI-GeneID: 7914699
NCBI-ProteinID: XP_002378176
UniProt: B8NBY9
Position
Unknown
AA seq 265 aa AA seqDB search
MPIDILPKVLFFDVFGTVVEWCPSVTRELKDAAERALHDPRKPIPPDERARVSQMTFTDW
LSIAEDWRQSYGQFTAQFDPSQGFVSVDQHHFTALSKLLQERKIGNLFTDSERWDLSLCW
HRLAPWPDSVRGLELLSRRFRTCTLSNGNVSLLEDLRRFGSLPFTDIASAEDFGAYKPSP
QVYRGAAARFDVDPSHCALVAAHLSDLKAAKAQGFQTIYVARSKEETEDIAQAKQEGYVD
LWIELNTGGFVEVARQLGIQVAIKL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcgatatacttcccaaggtcctgttcttcgacgtattcggaaccgttgtggaa
tggtgcccgtccgtcacgagagagttgaaagacgccgctgagcgcgcccttcatgatccc
cgcaagcctattcctccggatgaacgcgcacgggtctcacagatgacttttacagattgg
ctctcaattgcggaagattggcgacagtcctatggacagttcactgcccagtttgacccc
tctcaaggcttcgtttcggtcgatcagcaccatttcactgccctgtccaagctactccag
gaacggaagatcgggaatctcttcacagacagcgagagatgggatctgtcgctctgctgg
caccgacttgctccatggcctgacagcgtgcgaggcctggagctgttgagccgaagattc
cgcacgtgcaccctgtcaaacggcaacgtctctctgctagaggacctccggcgctttggc
tccttgccttttacggatatagccagtgcagaggactttggggcgtataaaccctcgcct
caggtgtatcgcggggcagccgcccgcttcgacgtggaccccagtcactgcgccctggtg
gcagcccatctctcagacctgaaggccgccaaagcacaaggttttcagacaatctacgtt
gcacggtctaaagaagagacggaggatatcgctcaagcaaagcaagaggggtatgtggat
ctttggatcgagctgaacacaggtggcttcgttgaggttgcacggcaactcggcattcaa
gtagcgattaagctatga

DBGET integrated database retrieval system