KEGG   Aspergillus flavus: AFLA_053960Help
Entry
AFLA_053960       CDS       T01090                                 

Definition
(RefSeq) fructose-bisphosphate aldolase, putative
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
afv  Aspergillus flavus
Pathway
afv00010  Glycolysis / Gluconeogenesis
afv00030  Pentose phosphate pathway
afv00051  Fructose and mannose metabolism
afv00680  Methane metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
afv01200  Carbon metabolism
afv01230  Biosynthesis of amino acids
Module
afv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
afv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
afv_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_053960
   00030 Pentose phosphate pathway
    AFLA_053960
   00051 Fructose and mannose metabolism
    AFLA_053960
  09102 Energy metabolism
   00680 Methane metabolism
    AFLA_053960
Enzymes [BR:afv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     AFLA_053960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-GeneID: 7908828
NCBI-ProteinID: XP_002383521
UniProt: B8NTB3
Position
Unknown
AA seq 218 aa AA seqDB search
MHFQGPHFVNYIVEAAHTASVPIGVHLDHCMDPADVEQALNLPIDSVMVDASRLEPEENI
EYCRQITEQAKIRGITVEAEMGRISDGEDGIPDASHLERCVHFLAPSSRNIHGPYPEGGS
EKYWQLDRLKLIADAIGPTIPRVIHGTHPVPDWLFHKAIATGARKININRNARDGYTAFV
AENADRLELTALKEQSVAIYQRSVEHLMDVLGSSGKAH
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcacttccaaggcccacatttcgtcaactacatcgtggaagccgcccacactgcctca
gtccctatcggggtccatctcgatcactgtatggatccagccgatgtcgagcaagcctta
aacctgcccatcgactccgttatggtcgatgcgtcgaggctggagccggaggaaaacatc
gaatattgcagacagatcacggagcaagccaagataaggggaatcactgttgaggccgaa
atgggacgtattagcgacggagaggacgggattccggatgccagccacctcgagagatgt
gttcatttcctggcgccttcatcccgcaatatccatggaccttatcctgaaggtggctct
gagaaatattggcagcttgaccggcttaaattgattgctgatgccattggtcctaccatt
cctcgggtaattcatggaacgcatcccgtcccggactggctttttcataaggccattgca
acgggggctcgtaagatcaatatcaaccggaatgctcgtgatggatacacagccttcgtg
gccgagaatgctgaccgcttggagcttactgctttgaaggaacagtccgtggcaatctat
caaagatcagtagaacacttgatggatgtccttggttcatccgggaaggcgcattag

DBGET integrated database retrieval system