KEGG   Aspergillus flavus: AFLA_066680Help
Entry
AFLA_066680       CDS       T01090                                 

Definition
(RefSeq) beta-galactosidase, putative
Organism
afv  Aspergillus flavus
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 BetaGal_dom4_5 BetaGal_dom2 BetaGal_dom3 Glyco_hydro_42
Motif
Other DBs
NCBI-GeneID: 7921095
NCBI-ProteinID: XP_002380227
UniProt: B8NJE7
Position
Unknown
AA seq 974 aa AA seqDB search
MRLWHIVSSAVAIAGLATAQDWPLHDNGLNQVVQWDHYSVIVNGERLFLWSGELHLWRIP
VPELWRDILEKIKAAGFNGIGLYEHWGWHAPNNETLDFETGAHNFAQAFEIAKELGLYII
YRPGPYSNAEANGGGFPGWLTTGEYGALRDDSEKYTRAWTRYSGAVAEYVRPYLITNGGP
IILWQIENEYGVQWLDPDLKTPNHSAINYMELLEEKHRGWDIDVPFTANNPSMWTRSWSK
DYGNVGGEVDLYGLDHYPVSRTQPSFLMEFQGGSFNPWDGPEGGCKDNMGPAWVNLFFRH
NLAQKVTAVNVYMLYGGTNWGNIGFPEVGTSYDYSAPIHETRLIGDKYNEAKLFGLFMRV
ARDFSKVERVGNSTQYATDQDIFTTELRNPDTGSAFYVTRHEYSPSTELTKFRLHVSTDI
GNLTVPTKGSITINGTESKVLVTDFPIGSSGKKITYTTLEILTVADLGDRQVVVFWAPEG
EEGEFLLKDAKSGKVMTGNADNKTVTTTRYGVVTSVGAGNEKTVIDYNHDVQAVVVDRQS
AYKFWAPTLNNNPLAWENSTVLVHGPHLVRTAEIDGDTIYITGDWDEETDIEIWAPKNVK
NVFFNGSKLKITKSKYGTLVGSLPAPEVMADSLLAELPPLTNWKVAENLPERLVDYDDSK
WTDANHMTTPHFVPPDTYPVLFADEYGYQAGNILWRGRFNASEESMPSGAYLRVIGGLAS
GFSAYVNGEFLGSWLGSMANKTGELEVSFKDVKLNTGDDNVLFVIQDTMGKEQRDAAPDP
RGILNATLIAADGSPTNFTSWKVAGNAGGNHLLEPIRGTYNEGGLHAERLGWHLPGFDDN
DWESGAPADGFTGADARFYRTVVPLNIPEGYDASLAFQLSTEKKAKLRAQLYVNGYQFAK
TLPYISNETTFPVFPGILDYNGNNTIGLSVWAMDEAGGRVDVAWKVMGVHRSAFDPLFDG
EYLRPGWKDRSQYA
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgtggcacattgttagcagtgctgtagcgattgctggcctagcaacggctcaa
gactggcccttacacgacaatggtctgaaccaggttgtccaatgggaccattacagtgtg
attgttaatggagagagactgttcctttggtcgggtgaattgcacctgtggcgtatccct
gtgcccgagctatggagagacatcctggagaaaatcaaggcagctggcttcaatggaatt
gggctttacgaacattggggctggcacgccccaaacaatgagaccttggattttgaaaca
ggggcacataactttgcccaagcttttgagattgctaaggagcttggtctttacatcatc
taccggcctggtccgtacagcaacgccgaagcaaacggcggaggcttcccaggctggctg
actactggggagtacggggccctgcgcgacgacagcgagaagtacaccagggcttggaca
cgatactctggagctgttgcggaatacgttcgtccatatctcatcacgaacggaggaccc
attatcctgtggcagatcgagaatgaatatggcgttcagtggcttgatcctgacttgaag
acacccaatcacagtgccatcaactacatggagctacttgaagagaagcacagaggctgg
gacattgatgtcccttttactgctaacaaccctagtatgtggactcgatcttggtcaaag
gattatggcaacgtaggtggtgaggtcgacctgtacggcctcgatcactatccggtgtcg
cggactcagccttcttttctcatggagttccagggaggctcattcaacccttgggatggg
cctgagggcgggtgtaaagataacatggggcccgcctgggtgaaccttttcttccgtcac
aacctggcccagaaggtgacagctgtcaatgtttatatgctttatggaggaaccaattgg
ggtaatatcggcttccctgaagttggcaccagttatgactactcggcgcccattcacgag
actcgtttgattggcgacaagtacaatgaagccaagctctttggtcttttcatgcgtgtt
gcccgcgatttctctaaggtggaacgagtggggaatagcacccagtatgctacggaccag
gatatcttcacaactgaactccgcaatccagacaccgggtctgccttttatgtcacccgc
catgagtactctccttccacagagctgaccaagttccggctgcacgtctccactgatatt
ggaaacctcacagtcccaactaaaggatccattactatcaatggaacggaatctaaagtc
ctggtcacggacttccccattggttcctccggaaagaagatcacttacacgaccttggag
atcctcacggtagctgacctaggagaccgtcaggtagtcgtattctgggctccggagggc
gaagaaggggaatttctacttaaagacgcaaagtccggcaaagtcatgaccggaaatgca
gataacaagacggtaacgacgactcgatatggtgttgtgaccagcgttggtgcaggaaat
gagaagacggttattgattataaccatgacgttcaagctgtggtggtagatcgccagtct
gcttacaagttctgggctcctacgttgaataataacccacttgcatgggagaattctacg
gtccttgtccacggaccccatctcgtccgcacggccgagatcgacggcgataccatctat
atcacgggtgactgggacgaagaaactgacattgagatctgggcaccgaagaacgtaaaa
aatgtcttcttcaatggctcgaagctgaagatcacgaagtctaagtatggaactctcgtt
ggtagccttcccgcccctgaagttatggcggatagccttctcgcagagctcccgccactt
accaactggaaggtagcagagaatcttccggagaggttggtggattatgacgactccaaa
tggaccgatgcaaaccatatgacaactccccatttcgttcctcccgatacctaccccgtt
ctgtttgctgacgagtatgggtaccaagcgggtaacattctctggcgaggaaggttcaac
gcctcggaagagagtatgccctcgggtgcttatcttcgtgtcattggcggtcttgccagc
ggcttttctgcgtatgtcaacggcgaattcctcgggtcctggctgggctcaatggccaac
aaaacgggcgagctagaggtatctttcaaggacgtcaagctcaatacaggagatgataat
gtcctatttgtcattcaggatacaatgggcaaggagcagcgtgatgccgcgccagaccca
cgaggcattcttaatgccacattgattgctgcagatggctcgcctactaatttcacctcg
tggaaagtggccggaaatgctggcggaaaccatctgcttgaaccaatacgtggcacgtac
aacgaaggcggccttcatgcagagcgccttggctggcatctccctggctttgatgacaat
gattgggagtcaggtgcccctgcggacggatttaccggcgctgatgcgcgcttttaccgt
accgttgtcccgttgaatattcctgaaggttacgacgccagcttggctttccagctaagc
actgagaagaaggcaaagctacgggctcaactatatgtcaacggttatcagtttgcaaaa
accttgccctacatttcgaatgaaacaactttccctgtatttcctggcatccttgactat
aatggcaacaacactatcggtctcagcgtgtgggctatggatgaagctggaggacgggtt
gatgtagcctggaaagtgatgggcgtgcatcgatcagcttttgatcctctatttgatggc
gaataccttcgacctggatggaaggatcgctcacaatatgcctga

DBGET integrated database retrieval system