KEGG   Aspergillus flavus: AFLA_067550Help
Entry
AFLA_067550       CDS       T01090                                 

Definition
(RefSeq) 1,4-beta-D-glucan-cellobiohydrolyase, putative
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
afv  Aspergillus flavus
Pathway
afv00500  Starch and sucrose metabolism
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFLA_067550
Enzymes [BR:afv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     AFLA_067550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7 DUF3467
Motif
Other DBs
NCBI-GeneID: 7919162
NCBI-ProteinID: XP_002380314
UniProt: B8NIG8
Position
Unknown
AA seq 465 aa AA seqDB search
MASLSLSKICRNALILSSVLSTAQGQQVGTYQTETHPSMTWQTCGNGGSCSTNQGSVVLD
ANWRWVHQTGSSSNCYTGNKWDTSYCSTNDACAQKCALDGADYSNTYGITTSGSEVRLNF
VTSNSNGKNVGSRVYMMADDTHYEVYKLLNQEFTFDVDVSKLPCGLNGALYFVVMDADGG
VSKYPNNKAGAKYGTGYCDSQCPRDLKFIQGQANVEGWVSSTNNANTGTGNHGSCCAELD
IWESNSISQALTPHPCDTPTNTLCTGDACGGTYSSDRYSGTCDPDGCDFNPYRVGNTTFY
GPGKTIDTNKPITVVTQFITDDGTSSGTLSEIKRFYVQDGVTYPQPSADVSGLSGNTINS
EYCTAENTLFEGSGSFAKHGGLAGMGEAMSTGMVLVMSLWDDYYANMLWLDSNYPTNEST
SKPGVARGTCSTSSGVPSEVEASNPSAYVAYSNIKVGPIGSTFKS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcttccctttccctctccaagatctgccgcaatgccctcatcttgtcctcagttctg
tcaactgcccagggtcagcaggttgggacttaccagaccgaaacccatccctcgatgacc
tggcagacatgcggtaacggcggtagttgcagcaccaaccaaggctccgttgtcctcgat
gccaactggcgttgggtccaccaaactggaagctctagcaattgttacaccggcaacaag
tgggatacttcctactgcagtaccaatgacgcatgtgcccagaaatgtgccctggatggt
gccgactactcaaacacttacggcatcaccaccagcggcagtgaggtccgtctcaacttt
gtcaccagcaactccaacggaaagaacgtcggttcccgtgtctacatgatggccgacgat
acccattacgaggtttacaagctgctgaaccaagagtttacctttgatgtggacgtctcc
aagctcccatgtggtcttaatggcgctttgtacttcgtcgtaatggatgccgatggaggt
gtttccaaatatccaaacaacaaagcgggtgctaagtacggtactggttactgtgactct
caatgcccacgggatctcaaatttatccagggacaggccaatgtcgaaggctgggtatcg
tcaaccaacaatgccaatacaggcactggaaaccatggctcctgctgcgcggagctggac
atatgggagtccaacagcatttcgcaggctctcactcctcacccatgcgatacgccgacc
aacactctatgcactggggatgcctgcggtggcacatatagttccgatcgctacagtggc
acgtgtgatcctgacggttgcgacttcaacccatatcgtgtgggcaacaccaccttctac
ggccctggcaagacaattgataccaacaaaccgatcacagttgtgacccagttcatcacc
gacgacggcacttccagcggcaccctatccgagattaaacggttctacgtgcaagatggc
gtcacgtacccccagcccagcgcagacgttagcggtctcagcggcaacaccatcaactct
gagtattgcaccgcggagaataccctgttcgaaggctcgggcagcttcgcgaaacatggt
gggctcgccggtatgggtgaagccatgtcgactggcatggtgctggttatgagcttgtgg
gatgattactatgccaacatgctctggcttgacagcaactaccccaccaacgagtccacg
agcaagcccggcgtggcccgtggaacttgttccacgtcgtctggcgttcctagcgaggtc
gaagcctccaaccctagcgcctatgtggcctattccaacattaaagttggccctatcggc
tccaccttcaagagctga

DBGET integrated database retrieval system