KEGG   Aspergillus flavus: AFLA_068140Help
Entry
AFLA_068140       CDS       T01090                                 

Definition
(RefSeq) MFS quinate transporter QutD
Organism
afv  Aspergillus flavus
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 7921572
NCBI-ProteinID: XP_002380373
UniProt: B8NIM7
Position
Unknown
AA seq 537 aa AA seqDB search
MSILSLVEDRPTPKEVYNWKIYLLAAVASCTSCMIGYDSAFIGTTISLQSFKDEFDWDSM
SAAHQDLVSSNIVSLYQAGAFFGAFFAYPIGHFWGRKWGLMVSALIFTLGAGIMLGTNGD
RGFGLLYGGRVLAGLGVGAGSNITPIYISELSPPAIRGRLVGVYELGWQIGGLVGFWICY
GVDETLPPSHKQWIIPFAVQLIPSGLLIIGALFLKESPRWLFLRGRREEAIKNLCWIRQL
PEDHVYMIEEIGAIDQTLEHQRATIGLGFWKPFAAAWTNKKILYRLFLGSMLFFWQNGSG
INAINYYSPTVFKSIGVTGSNTSLFTTGIFGVVKTVVTFIWLLWLIDRVGRRLLLLIGAA
GGSICLWIVGAYIKIARPSERENKQMDGGGIAAMFFFYLWTVFYTPSWNGTPWVINSEMF
DPNIRSLAQACAAGSNWLWNFLISRFTPQMFAKMDYGVYFFFASLMILSIIFVFFLIPET
KGIPLESMDRLFETQPIWRAHGTLLKQIREDEERFRHDLEDSGFVKSTDRQVEVVDA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcctctctctagtcgaggatagaccaactcccaaggaggtgtacaactggaag
atttacctcctcgcagctgttgcctcatgcacgtcttgtatgatcggatatgatagtgcc
ttcattggtacaactatatctctccagtcattcaaggatgagtttgattgggactccatg
tctgccgcgcaccaagacctagtgagctccaacattgtctctctctaccaggcgggtgca
ttctttggtgcattcttcgcctatcctatcggtcatttttggggtcgaaaatggggcctg
atggtctctgctttaatatttacattgggtgccggcataatgctgggtactaatggcgac
cgtggatttggtttactttatggaggacgagtgcttgctggcttgggagtgggagctggc
tccaatatcactcctatttatatctccgagttatctccaccggcgatcagaggacggttg
gttggggtttacgaattggggtggcaaattggtgggcttgtaggcttttggatctgttac
ggcgttgatgaaacgctgcccccgagtcataagcagtggatcatcccattcgctgtccag
ctgatcccatctggccttcttattattggtgccctgtttttgaaagagtctccacgttgg
ctattcctgcggggacgtcgagaggaagcaatcaaaaacctctgctggattcgccaactc
ccagaagaccacgtctacatgattgaggagatcggtgctattgaccagaccctagaacac
cagcgtgcaactattggtctgggtttctggaagccgttcgctgcggcatggacgaacaag
aagatactgtatcgcctcttccttggtagcatgctgttcttttggcagaatggttcagga
atcaacgccatcaactattattctcctaccgtcttcaaaagcattggtgtcacaggttcg
aacacaagcttgttcaccacgggtatctttggtgtcgtgaagaccgtggtgacatttatc
tggcttctttggctgattgaccgtgtgggacgacgtttgctcctcctcattggtgccgcc
ggtggctcgatctgtttgtggatcgtgggcgcatatatcaaaatcgctaggccttcagaa
agagagaacaagcagatggatggcggtggcattgctgctatgttcttcttctatctgtgg
acagtgttttataccccttcctggaacggtaccccatgggttattaactcggaaatgttc
gatcccaacattcgatcgcttgcgcaagcctgcgcggcagggtccaactggctctggaac
ttcctcatctcccggttcactccacagatgtttgccaagatggactacggggtgtacttc
tttttcgcgtctctcatgatcctgtccatcatctttgtgttcttcctcattccagagacg
aagggtatcccactggagagtatggaccgtctttttgagacccagccgatttggcgtgct
cacgggactctcctcaaacaaattcgcgaagatgaggaacggtttcgtcatgacttggag
gattccggctttgtgaagagcaccgataggcaagtggaggtcgtggatgcttaa

DBGET integrated database retrieval system