KEGG   Aspergillus flavus: AFLA_076070Help
Entry
AFLA_076070       CDS       T01090                                 

Definition
(RefSeq) septin AspB
  KO
K16944  septin 7
Organism
afv  Aspergillus flavus
Brite
KEGG Orthology (KO) [BR:afv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:afv04131]
    AFLA_076070
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:afv04812]
    AFLA_076070
   04147 Exosome [BR:afv04147]
    AFLA_076070
Membrane trafficking [BR:afv04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    AFLA_076070
Cytoskeleton proteins [BR:afv04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     AFLA_076070
Exosome [BR:afv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AFLA_076070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU ABC_tran AAA_22 AIG1 AAA_16 Roc Ras AAA_29 AAA_24 Dynamin_N AAA_7 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 7914086
NCBI-ProteinID: XP_002372524
UniProt: B8MX20
Position
Unknown
AA seq 523 aa AA seqDB search
MVHTRRRSAEGHSKVDSQRFSASPSLKHHRSKSFTSCSPTRGTLSTENQSDITPVTDLTL
PVVASPPPTNGSPTPAVESPESSKPSSPFVERSNPMGSGNAQTVSSSDPKAVAQAATDMK
NVVRRKLTGYVGFANLPNQWHRKSVRKGFNFNVMVVGESGLGKSTLVNTLFNTSLYPPKE
RTGPSHDIIPKTVAIQSISADIEENGVRLRLTVVDTPGFGDFVNNDDSWRPIVENIEQRY
DAYLEAENKVNRTNIVDNRIHACVYFIQPTGHSLKPLDIEVMRRLHTKVNLIPVIAKADT
LTDEEIAQFKQRILADIQHHSIQIFEGPRYELDDEETIAENQEIMSKVPFAVVGANAEVA
TADGRKVRGRSYPWGTIEVDNEEHCDFVKLRQMLIRTHMEELKEHTNNHLYENYRSDKLT
QMGVAQDPSVFKEVNPAVKQEEERALHEQKLAKMEAEMKMVFQQKVAEKESKLKQSEDEL
YARHREMKDQLERQRQELDEKKSRLESGRPIEEKGKRKGFSLR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggtacataccagacgccggagtgcagagggtcactcgaaagtagactcgcaacgattc
agtgcttccccgtcgttgaaacaccatagatccaaaagctttacgtcatgttcgccaact
cgggggactttgtctaccgaaaaccaatccgatatcacaccagttactgacttgactttg
cctgttgtagcttcaccaccccccaccaacggctcccccaccccggccgtggagtctcct
gagagcagcaagcccagttctccctttgtggagcgcagcaaccccatgggatcaggaaac
gcacaaaccgtcagctccagtgacccgaaggctgtggcccaggctgccaccgacatgaag
aacgttgttcgccgcaagttgactggctacgtcggttttgccaacctgcccaaccaatgg
caccgtaaaagtgttcgcaagggattcaacttcaacgtgatggttgttggtgaatctggt
ctcggaaagtcgacccttgtcaacactctctttaacacctctctttacccccctaaggag
cgcaccggccctagccacgacatcatcccgaagaccgtggccatccagtctatcagcgca
gacattgaagagaacggcgttcgtcttcgcctgaccgtggttgacaccccgggattcggt
gatttcgtgaacaacgacgattcgtggcgccctattgtagagaacattgagcagcgatac
gatgcctacctggaggctgagaacaaggtcaaccgcactaacattgttgacaaccgtatc
cacgcctgtgtctacttcatccagcccaccggccactcccttaagcctctggacattgag
gtcatgcgccggttgcacaccaaggtcaacctgatccctgtgatcgccaaggccgatacc
ttgacggacgaggagattgctcagtttaagcagagaatccttgccgatatccaacaccac
tccatccagatctttgagggcccccgctacgaactcgacgacgaagaaaccatcgccgag
aaccaggagatcatgtcgaaggtccccttcgctgtggtcggtgccaacgctgaggtcgcc
actgctgacggccgtaaggtccgaggccgtagttacccatggggtaccatcgaggtcgac
aacgaggaacactgtgactttgtcaagctgcgccagatgttgatccgcacccacatggaa
gagctcaaggaacacaccaacaaccacctgtacgagaactaccgctccgacaagctgacc
cagatgggtgtcgcccaggacccgagcgtgttcaaggaagtcaacccggccgtcaagcag
gaggaagagcgtgccctgcacgagcagaagctcgccaagatggaggcagagatgaagatg
gtcttccaacagaaggtggccgagaaagagagcaagctgaaacagagcgaagacgaacta
tacgctcgacatcgcgagatgaaggatcaactggagcggcaacgccaggaactggacgag
aagaagagtcgcctcgaaagtggtcgaccgatcgaagagaagggcaagcgaaagggcttc
tctcttcgttag

DBGET integrated database retrieval system