KEGG   Aspergillus flavus: AFLA_076200Help
Entry
AFLA_076200       CDS       T01090                                 

Definition
(RefSeq) HAD superfamily hydrolase, putative
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
afv  Aspergillus flavus
Brite
KEGG Orthology (KO) [BR:afv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:afv01009]
    AFLA_076200
Enzymes [BR:afv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     AFLA_076200
Protein phosphatases and associated proteins [BR:afv01009]
 HAD phosphatases
  Other HAD phosphatases
   AFLA_076200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-GeneID: 7914099
NCBI-ProteinID: XP_002372537
UniProt: B8MX33
Position
Unknown
AA seq 227 aa AA seqDB search
MAIREKAGFPAIRACIFDLDGLLINSEDIITFSTSQPLEKYKSTPFDRTIRAQLMGIPHS
TNGDTFHSWAKLPISSEQFAHESTENMRQHFLACRPLPGAERILSTLSQARSAASGDRIE
LALTSSTKSRSYELKISRPETKRLLGFFSPDRRVLGDDPRVRQGRGKPAPDIYLVALQSL
NLAAAASDVKPILPHECLVFEDSVIGCRGWKTGWDESCLGSASRCCG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggctatccgtgagaaggctggtttcccggccatccgcgcctgcatattcgacctggat
gggcttctcatcaactccgaagatataataactttctccacgagccaacccctcgagaag
tataagagtactccctttgaccggacgattcgagcccagctcatgggtatcccacactcg
accaatggcgacacgttccacagctgggccaaactgcctatctccagcgaacaattcgct
catgagtcgactgagaacatgagacaacattttctagcttgcaggccgcttcctggcgcg
gagaggattttgtcgacccttagccaggcacgcagtgctgcgtcgggagacagaatcgag
ctggcattaacatccagcaccaaaagccgcagctacgaattgaagatctcaaggccggaa
acgaaacgcttacttggcttcttctcgcctgataggcgggtcttgggtgatgatccacgg
gtgcggcaggggcgagggaagccagcaccggatatatatctcgtggcgctgcaatctttg
aacttggcggcagcggcctctgatgtgaagcccattttgccccatgaatgtttggtgttt
gaagacagcgtgatcggatgtagaggctggaagacgggctgggatgagagttgtttgggt
tccgcatccagatgttgcgggtga

DBGET integrated database retrieval system