KEGG   Aspergillus flavus: AFLA_078900Help
Entry
AFLA_078900       CDS       T01090                                 

Definition
(RefSeq) beta-N-acetylhexosaminidase NagA, putative
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
afv  Aspergillus flavus
Pathway
afv00511  Other glycan degradation
afv00513  Various types of N-glycan biosynthesis
afv00520  Amino sugar and nucleotide sugar metabolism
afv00531  Glycosaminoglycan degradation
afv00603  Glycosphingolipid biosynthesis - globo and isoglobo series
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFLA_078900
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    AFLA_078900
   00531 Glycosaminoglycan degradation
    AFLA_078900
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    AFLA_078900
   00604 Glycosphingolipid biosynthesis - ganglio series
    AFLA_078900
   00511 Other glycan degradation
    AFLA_078900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:afv03110]
    AFLA_078900
Enzymes [BR:afv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AFLA_078900
Chaperones and folding catalysts [BR:afv03110]
 Intramolecular chaperones
  Others
   AFLA_078900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b GHL6
Motif
Other DBs
NCBI-GeneID: 7915250
NCBI-ProteinID: XP_002372807
UniProt: B8MXV3
Position
Unknown
AA seq 600 aa AA seqDB search
MRISQICTVLSTVTSAVAVGVNPLPAPREISWGSSGPKSIAGELQLRTDSDSADGIVADA
WNRAWETIVALRWVPAATEAPISSFEPFPTPTAGASKKSKRASNSLQYVNVQVKDIEADL
QHGVDESYTLDVEEDSDTITINAETVWGALHAFTTLQQLVISDGHGGLIIEEPVNIKDSP
LYPYRGIMLDTGRNFVSLPKIFEQLEGMSLSKLNVLHWHIDDAQSWPIWVDVYPEMVKDA
YSPHEIYSRNDVRNIVNYARARGIRVIPEIDMPSHSSSGWKQVDPEMVTCTDSWWSNDDW
PLHTAVEPNPGQLDIIYNKTYEVVGNVYKELSDIFPDHWFHVGGDEIQPNCFNFSTHVTK
WFAEDPSRTYHDLAQYWVDHAVPIFQNYSQERRLVMWEDIALSADNAHDVPKNIVMQSWN
NGLEYISNLTARGYDVIVSSSDFLYLDCGHGGFVTNDPRYNVMANPDANTPNFNYGGNGG
SWCAPYKTWQRIYDYDFTLNLTETQAKHIVGATAPLWGEQVDDINVSSMFWPRAAALAEL
VWSGNRDANGNKRTTEMTQRILNFREYLVANGVQAQALVPKYCLQHPHACDLYRNQTAIQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcggatctcccagatctgcaccgtgctctccacggtaacctcagccgtcgctgttggt
gtaaatcccttgccggcgccgcgtgagatctcctggggttcctccggtcccaagtccatc
gccggagagctgcagctgcgcaccgactctgactcggctgacgggattgtggccgatgca
tggaatcgtgcatgggagaccatagtcgccttgcgatgggtccccgctgctacggaagct
cccatctcctccttcgaacctttcccaacccccacagcgggcgcttccaaaaagtcgaag
cgtgcctcaaattcactgcaatatgtcaacgtacaagtcaaagacattgaggccgatctt
cagcacggtgttgatgagtcttacacgctcgatgtggaggaggattcggataccatcaca
attaatgctgagaccgtttggggtgctctgcatgcatttaccactcttcaacagctggtc
atatccgatggccatggcggtctgattatcgaagagccagtcaacatcaaagattctcca
ctttatccctaccgtggaatcatgcttgatactggtcgtaacttcgtctccctgcccaaa
atattcgaacagctggagggcatgtccctttcgaaactcaacgtcttgcactggcacata
gacgatgcgcaatcttggcctatttgggtcgacgtttatcccgagatggtcaaagatgct
tattcgccccatgagatttactcgcgcaatgatgtccgcaacattgtcaattatgctcgg
gctcgtggtattcgtgtgattcccgaaatcgacatgccaagtcactcctcgtcaggctgg
aagcaagttgaccccgaaatggttacttgcacagattcctggtggtccaatgatgactgg
cctctccataccgcggttgagccaaatccaggtcagcttgacatcatctacaacaagact
tacgaggtcgtcggcaatgtttacaaggagctgtcggacattttccctgaccattggttc
catgtcggaggagacgagatccaacctaactgcttcaatttcagtacccacgtcaccaag
tggtttgctgaggatccctcgcgcacgtaccacgacctggctcaatactgggttgatcat
gccgtgcctattttccagaactacagccaagaacgccgtctggttatgtgggaggacatt
gcgctgtccgcggataatgcacatgatgtgcccaagaacattgtaatgcagagctggaac
aatggtctagagtacatctcaaacttgaccgctagaggctacgacgtcatcgtgtcttcc
tctgactttctgtacctggactgtggtcatggaggctttgtcaccaacgacccgcggtac
aatgtgatggctaacccagatgcgaatacccctaacttcaactatgggggcaatggagga
tcgtggtgcgccccttacaaaacctggcaacgtatctacgactacgacttcactctcaac
ctcactgagacgcaagctaagcatatcgttggcgcaaccgctcctctttggggcgagcaa
gttgatgatatcaacgtctctagcatgttctggcctcgtgctgcagctctggcagagcta
gtctggtccggaaaccgcgacgctaatggcaacaagcgcaccaccgagatgacacagcgt
atccttaacttccgtgaatacctcgttgcgaatggtgttcaggctcaagctctggttccg
aagtactgcttgcaacatcctcatgcttgcgatctctaccgtaaccaaaccgcaattcag
taa

DBGET integrated database retrieval system