KEGG   Aspergillus flavus: AFLA_094630Help
Entry
AFLA_094630       CDS       T01090                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afv  Aspergillus flavus
Pathway
afv00010  Glycolysis / Gluconeogenesis
afv00051  Fructose and mannose metabolism
afv00562  Inositol phosphate metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
afv01200  Carbon metabolism
afv01230  Biosynthesis of amino acids
Module
afv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
afv_M00002  Glycolysis, core module involving three-carbon compounds
afv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_094630
   00051 Fructose and mannose metabolism
    AFLA_094630
   00562 Inositol phosphate metabolism
    AFLA_094630
Enzymes [BR:afv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AFLA_094630
Exosome [BR:afv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AFLA_094630
  Exosomal proteins of bladder cancer cells
   AFLA_094630
  Exosomal proteins of melanoma cells
   AFLA_094630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 7919555
NCBI-ProteinID: XP_002381283
UniProt: B8NM07
Position
Unknown
AA seq 251 aa AA seqDB search
MPRQFFVGGNFKMNGTAESITAIIKNLNEAKLDETTEVVVSPPALYLTLAQQVADEKKKV
AVSSQNVFDKPNGAFTGEISVSQLQDAKIPWTIIGHSERRVILKETDEFIARKVKAAIDG
GISVIFCIGETLEEREADKTIEVVTKQLNAAAKELTKEQWSKVVIAYEPVWAIGTGKVAT
TQQAQEVHAAIRKWLADAISPEASENTRIIYGGSVSEKNCRELAQERDVDGFLVGGASLK
PAFVDIINARL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgccaattcttcgtcggtggtaacttcaagatgaacggtactgcggaaagcatt
accgccatcatcaagaacctcaacgaggccaagctcgacgagaccaccgaggtcgtcgtc
tcccctcctgctctctacctgaccctcgcccaacaggtcgccgacgagaagaagaaggtt
gccgtttcctcccagaacgtcttcgacaagcccaacggtgctttcaccggtgagatctcg
gtttctcagctgcaggatgccaagatcccctggaccatcattggacacagcgagcgccgt
gtcatcctgaaggagactgacgagttcattgctcgtaaggttaaggctgccattgacggt
ggcattagcgtcattttctgcatcggtgagactcttgaggagcgtgaggccgacaagacc
atcgaggttgtcaccaagcagctcaacgctgccgctaaggagctcaccaaggagcagtgg
tctaaggtcgtcattgcctacgagcccgtctgggccatcggtaccggcaaggtcgctacc
acccagcaggcccaggaggtccacgccgccatccgcaagtggctcgccgatgccatctcg
cccgaggcctccgagaacacccgtatcatctacggtggctccgtcagcgagaagaactgc
cgcgagttggcccaggagcgcgatgtcgatggcttcctggttggcggtgccagcttgaag
cctgctttcgttgatatcatcaatgctcgtttgtaa

DBGET integrated database retrieval system