KEGG   Aspergillus flavus: AFLA_097890Help
Entry
AFLA_097890       CDS       T01090                                 

Definition
(RefSeq) Glycosyl hydrolases family 32 superfamily
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
afv  Aspergillus flavus
Pathway
afv00052  Galactose metabolism
afv00500  Starch and sucrose metabolism
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFLA_097890
   00500 Starch and sucrose metabolism
    AFLA_097890
Enzymes [BR:afv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AFLA_097890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N DUF4975
Motif
Other DBs
NCBI-GeneID: 7910664
NCBI-ProteinID: XP_002383662
UniProt: B8NTE9
Position
Unknown
AA seq 619 aa AA seqDB search
MKLSTASALVTSQAAYAASAIDYNAAPPNLSTLANGSLYDTWRPRAHILPPNGRIGDPCG
HYTDPDTGLFHVGFLYNGSGIAGATTDDMVRFRDLNPNGSQFITPGGKNDPVAVFDGSVI
PKGIDGKPTLLYTSVTSLPIHWSIPYNPGAETQSLAVTSNGGRNFTKLDRPPVIPLPPSD
SDVTAFRDPYAFQSPELDAAADSAPGTWYTAISGGVHEDGPGQFLYRQDQKEMSLESWEY
LGLWWQEKVNTTWGNGDWAGGWGFNFETGNVFGLNEEGYSVDGEMFMTLGTEGSGTPIVS
QVSSIHDMLWAAGNVSNNGNVTFTPTMAGVFDWGASGYAAAGHILPATSQVSTKSGAPDR
FISFVWLTGDLFEQAKGYPTSQQNWVGTLLLPRELHIKTISNVVDNELAREEGSSWRVER
GQSGIELKTLGIDIARETREALMSGPKITEPERTSKEAGLVPFQVSPTTKFHVLTAQLSF
PRSARNSDLQAGFQVLSSDLESTTIYYQFSNESIIVDRSNTSAAAKTTNGIVSTNESGRL
RLFDLQGDAQEIETLDLTVVVDNSVLEIYANGRFALSTWARSWYKNSTDIKFYHNGAGEV
TFSNVTVSEGLFEAWPERV
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctcaaccgcgagtgccttggtcaccagccaggcggcctacgctgcctccgcc
atcgattacaacgcagctcccccaaacctttcgactttggccaatggctctctgtatgac
acgtggagacctagagctcatatcctcccaccaaacggccgaattggcgacccgtgtggt
cattacactgatcctgacaccggtctgttccacgttggcttcctgtacaatggcagtggt
atcgcaggcgctacgaccgatgatatggtcagattccgtgatctgaatcccaacggaagt
caattcatcacgcctggtggcaagaatgatcctgtagcggtctttgatggctctgtaatc
cctaagggaattgacggcaagcccaccctactctacacctccgtcacatcactccctatc
cattggtcaatcccctacaacccaggagccgaaacgcaatccttggccgtcacatccaac
ggcggtcgcaattttaccaagctcgatcgtccaccggtcattcccctccctccgtccgac
agcgatgtgaccgctttccgtgacccctacgctttccaaagcccggagctggacgctgcc
gcggacagcgccccggggacctggtacacagccatctctggtggtgtccacgaagatggc
cctggtcagttcctctatcgtcaggaccagaaggaaatgagcctcgagagctgggagtat
cttggcttgtggtggcaggagaaggtcaacacgacctggggtaacggcgactgggccgga
ggatggggcttcaacttcgagaccggtaacgtcttcggtctgaacgaggaagggtacagc
gtcgatggtgagatgttcatgaccttgggtactgagggatccggaactcctattgtgtcc
caggtgtcatccattcacgatatgctgtgggctgctggcaacgtctctaacaacggaaat
gtcactttcaccccaactatggccggtgtcttcgactggggtgcttctggctatgctgcc
gctggtcatattctgcccgcaacttctcaggtgtccacaaagagtggcgcccccgaccgt
ttcatctcgtttgtctggttgaccggagacttgttcgagcaggccaagggttaccccact
tcgcaacaaaactgggttggcacccttctgcttcctcgcgagctgcacatcaagaccatc
tccaacgtggttgataatgagcttgcccgggaagagggatcatcttggcgcgtagagcgt
ggccagtctggcattgagctgaagaccctgggaattgatattgctcgggagacgcgtgaa
gctctcatgtctggaccgaagatcaccgagcccgagcgcacatcgaaggaggctggcctc
gtgcctttccaggtctccccgaccaccaagttccacgtcctgaccgcccagctgtctttc
cctcgctctgcccgtaattctgatctccaggccggattccaagtgctgtcgtctgacctc
gaaagcaccactatctactaccagttctccaatgagtcaatcatcgtcgaccgcagcaac
accagtgctgccgcgaagaccaccaatggaatcgtcagcaccaatgagtctggacgtctc
cggttgttcgatttgcagggcgatgcccaggaaattgagactctggacctcacggtcgtt
gtggataactctgtcctcgagatctatgccaatggacgctttgccctgagtacttgggct
cgttcctggtacaagaactcgactgacatcaagttctaccacaacggtgcgggtgaagtg
acattcagcaatgttactgtctccgagggcctgtttgaagcctggccggagcgtgtctaa

DBGET integrated database retrieval system