KEGG   Aspergillus flavus: AFLA_100460Help
Entry
AFLA_100460       CDS       T01090                                 

Definition
(RefSeq) NADPH cytochrome P450, putative
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
afv  Aspergillus flavus
Pathway
afv00071  Fatty acid degradation
afv00380  Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AFLA_100460
  Amino acid metabolism
   00380 Tryptophan metabolism
    AFLA_100460
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AFLA_100460
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AFLA_100460
Cytochrome P450 [BR:afv00199]
 Cytochrome P450, bacteria type
  CYP102 family
   AFLA_100460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 NAD_binding_1 FAD_binding_6
Motif
Other DBs
NCBI-GeneID: 7912927
NCBI-ProteinID: XP_002383918
UniProt: B8NUJ3
Position
Unknown
AA seq 444 aa AA seqDB search
MAEHGGARLAPRGSADTAEDDPFAELESWSERSVWPGLEAAFNLARHNSSDGTGKSTRIT
IRSPYTLRAAHETAVVHQVRVLTSAETTKKVHVELALPDTMNYRPGDHLAILPLNSRQSV
QRVLSLFQIGSDTILYITSSSATSLPTDTPISAHDLLSGYVELNQVATPTSLRSLAAKAT
DEKTAEYLEALATDRYTTEVRGNHLSLLDILESYSVPSIEIQHYIQMLPLLRPRQYTISS
SPRLNRGQASLTVSVMERADVGGPRNCAGVASNYLASCTPGSILRVSLRQANPDFRLPDE
SCSHPIIMVAAGSGIAPFRAFVQERSVRQKEGIILPPAFLFFGCRRADLDDLYREELDAF
EEQGVVTLFRAFSRAQSESHGCKYVQDLLWMERVRVKTLWGQDAKVFVCGSVRMNEGVKA
IISKIVSPTPTEELARRYIAETFI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacatggtggagctcgtctagccccgcgagggtcggcggatactgcagaagat
gaccccttcgcggaattagagtcatggtcggaaaggagcgtctggcctggtcttgaggct
gccttcaatcttgcgcgccataactcatcggatgggactggaaagagcaccaggataacc
attcgatcaccctacacgttgcgcgctgctcacgaaacagctgtcgttcatcaagttcgc
gtgttgacatccgcggaaaccactaagaaagtccatgttgagctggccctgccagataca
atgaactaccgtcctggtgatcatctagccattttgccccttaactctcggcagagtgtg
cagcgggtactttcacttttccaaatcggttcagataccattttgtatattacttctagc
agtgccacctccttgccgacagatacccctatatctgcccacgacctgttgagcggctat
gtggaattgaatcaagtggctacgcccactagcttgagatcgttggctgcgaaagccacc
gatgagaaaactgcagagtatcttgaagccctcgccacagatcgatacacaacggaagtc
cggggaaaccatttgtccctattggacatattagaaagctattccgtaccctcgattgaa
attcagcattatatccagatgttgcctctccttcggccccgccaatacaccatttcctca
tctccgcgattgaaccgtggccaggcttcattgactgtttccgttatggagagagcagac
gttggcgggcctagaaactgtgctggggtagcatcaaactacctagcgagctgcaccccc
gggtcgatcctccgagtgtctctgcggcaggcaaatcctgacttccgactcccagatgag
tcgtgctctcaccccataatcatggttgccgctggatcaggcattgcacccttccgcgca
tttgtccaggaaagatccgtccgacagaaggaaggaatcatcttacccccggccttcctg
tttttcggttgcaggagagctgacttggatgatctctatcgcgaggagttggatgctttc
gaggaacaaggggtggtaacgctctttagagcttttagcagagctcagagcgagagccat
ggctgcaaatacgtccaagatttgctatggatggaaagagtgagggtgaaaacgctttgg
ggacaagatgctaaggtcttcgtctgcggcagcgttagaatgaatgaaggggtgaaggcg
ataatttcaaagattgtttctcctacaccgacagaagaactcgcgcggcgatatatagct
gagacttttatatga

DBGET integrated database retrieval system