KEGG   Aspergillus flavus: AFLA_106550Help
Entry
AFLA_106550       CDS       T01090                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase, putative
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
afv  Aspergillus flavus
Brite
KEGG Orthology (KO) [BR:afv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AFLA_106550
Enzymes [BR:afv01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AFLA_106550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase zf-CDGSH
Motif
Other DBs
NCBI-GeneID: 7917337
NCBI-ProteinID: XP_002376526
UniProt: B8N861
Position
Unknown
AA seq 213 aa AA seqDB search
MSVTLHTTQGDLKVELFCEAVPKTVENFLALCACGAYNNTPFHRLIPGFMIQGGDISLGP
AAHQSQESTKPMLPFDDIPKGGTSINHPGALNQEIHLPALRHNTRGILSMAARPVKDRTA
PGSQGAMGATINGSQFFITFAPAPHLDGNSTVFGKVLNLTAQDEGGDVLTKLEKANVKVD
KKGRVVQPKEGEESEYEALRINRVTIHANPLAK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttactctccacaccacccaaggcgacctgaaggtcgagctcttctgcgaggca
gtgcctaaaacagtagagaacttcctcgccctttgcgcatgcggcgcatacaacaacaca
cccttccaccgtctaatccccggcttcatgatccaaggaggcgatatttctctcggacca
gcagcgcaccaatcgcaagaaagcactaaacccatgcttcccttcgacgacatccccaaa
ggcggtacatcaatcaaccaccccggcgcattgaaccaagaaatccacctccccgctctt
cgacacaacacgcgcggaatcctctctatggcagcgcggccagtcaaagatagaacagct
cccggctcccagggtgctatgggggctacaattaatggaagtcaattcttcattacgttt
gctcctgcccctcatttggacggaaatagcacggtcttcgggaaggtgttgaacttgaca
gcacaagatgaagggggtgatgtgttgaccaaattagagaaggcgaatgtgaaggtggat
aagaaagggagggttgtgcagccgaaagagggtgaggagtcggaatatgaagcactgcgc
attaacagggtcacgatacacgcgaatccacttgcaaagtga

DBGET integrated database retrieval system