KEGG   Aspergillus flavus: AFLA_106720Help
Entry
AFLA_106720       CDS       T01090                                 

Definition
(RefSeq) ceramide synthase membrane component (LAG1), putative
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
afv  Aspergillus flavus
Pathway
afv00600  Sphingolipid metabolism
afv01100  Metabolic pathways
Module
afv_M00094  Ceramide biosynthesis
afv_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AFLA_106720
Enzymes [BR:afv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     AFLA_106720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 7917354
NCBI-ProteinID: XP_002376543
UniProt: B8N878
Position
Unknown
AA seq 443 aa AA seqDB search
MARGRSSSNLGADIPGDTSAPAMSTMNEVSPIETEAPKWNKSSEKSLKSQPKRRKSRSLL
RRFKDKCLKHTWLLPLLMVVVLLALYAVNPNPSNPLHSAIFLSYPQGPKTPGGPVMYGKG
PKDVAFVSFYTIVLSFTREFIMQRIIRPWAIYCGIRGKGKTARFMEQVYTAIYFGIFGPF
GLYVMYRSDIWYFNTTAMYEGFPHREHEALFKAYYLLQASYWAQQAIVLLLQLEKPRKDF
KELVGHHIITLALIALSYRFHFTYMGLAVYITHDVSDFFLATSKTLNYLDSFITAPYFGM
FVGIWIYCRHYLNLKILWAVLTEFRTVGPFELNWETQQYKCWISQYITFALLASLQAVNL
FWLFLILRILKNYLFNSIRKDERSDDEDTEEEEEAEQGQSGRATLATGAEVSTVTARNVG
KENQAPQVLVNGEPLNEKSSSRR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcggccggagctcgagtaacttgggcgcggacataccgggtgacaccagcgca
ccagcgatgtcgaccatgaatgaggtcagtccgattgaaacggaggctccaaagtggaat
aagtcttccgagaagtcgctgaagtcgcaaccgaagcgtcgcaagagccgatccctactc
cgccgctttaaagacaaatgcctgaaacatacatggctcctgcctctcctcatggtggta
gttctgctcgccctgtatgcagtcaaccccaacccgtccaatccgctacatagcgcaatc
tttctgtcctaccctcaaggaccgaaaacccctggtggcccggttatgtatggaaaaggt
cccaaggacgttgcctttgtctcgttctacaccattgtcttatccttcactcgggaattc
atcatgcagcgcatcatccggccgtgggcgatatactgcggaatccgcggcaaaggcaag
actgctcgcttcatggagcaggtgtacacagcgatctacttcggcatcttcggtccattt
ggcttgtacgtgatgtaccggtctgatatctggtatttcaacacaacggcgatgtacgag
ggtttcccgcaccgggagcatgaagcgctattcaaggcctactatctgttgcaagcgagc
tactgggctcaacaagccatcgtgctcttactccagctggagaagccccgaaaggacttc
aaagaacttgtcggacatcacatcatcaccttggccctcatcgcgctgagctatcgattc
cacttcacctacatgggccttgcggtctacatcacgcacgatgtttctgatttcttcctt
gcaacttcgaaaacactcaactacctggactcattcattactgcgccatacttcggtatg
tttgttggaatttggatctactgccgccactacctgaacctgaagattctctgggcggtt
cttaccgaattccgaaccgttggtcctttcgagctgaactgggagacccagcaatacaag
tgttggatcagtcaatatatcacctttgccttgctggcgagcttgcaggccgtcaacctt
ttctggctctttttgatccttcgcatcctcaagaactacctcttcaacagtatcaggaag
gatgagcgcagtgatgacgaggatacggaggaagaggaagaagcagaacaggggcaaagc
ggccgtgctactctagcgactggagctgaagtgtccaccgttactgcccgtaatgtcggt
aaggagaaccaggctccccaagttctagtgaacggggagcccctcaacgagaagtcctct
agccgccggtag

DBGET integrated database retrieval system