KEGG   Aspergillus flavus: AFLA_107540Help
Entry
AFLA_107540       CDS       T01090                                 

Definition
(RefSeq) transketolase, putative
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
afv  Aspergillus flavus
Pathway
afv00680  Methane metabolism
afv01100  Metabolic pathways
afv01200  Carbon metabolism
Module
afv_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AFLA_107540
Enzymes [BR:afv01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     AFLA_107540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh PepSY_2
Motif
Other DBs
NCBI-GeneID: 7913400
NCBI-ProteinID: XP_002376625
UniProt: B8N8G0
Position
Unknown
AA seq 708 aa AA seqDB search
MAVGPVTINGSGKSALPLVQQMSKDHDIVLKTFRMLISDLCQQFGGGHPGGAIGMAAIGV
ALWRYVMRYAPHTPDFFNRDRFILSNGHTCLFQYSFLHLTGYKAMTFDQLKSYHSDRVDA
LCPGHPEIEHEGIEVTTGPLGQGVANAVGLAMATKNLAAKFNQPGYDVVNNHTWCMIGDA
CLQEGVGLEAISYAGHLKLNNLTIIYDNNQITCDGSVDLTNTEDINGKMRASGWDVIDVE
DGCYDVEGLVRALEQARASTEKPTFINVRTVIGLGSNVAGQAAAHGAAFGAPNVAQMKKE
NGFNPDEHFVIGETVRKFFEDLPARGESLVQEWKDLVKQYTAQYPELGAEFQRRMSGELP
SNWKDLIPASFPEKPTASRASSGLVFNPIAKEIENFMVGTADLSPSVNMIWPGKVDFQHP
DLRTTCGINGNYGGRYIHYGVREHAMCAISNGLAAYAPNTFIPITSSFFMFYLYAAPAVR
MGALQHLQIIHAATHDSIGMGEDGPTHQPIELAALYRAMPNLLYIRPGDSEETAGAWIAA
IEAKKTPTIISTSRHTLPQLKQTSRDGVARGAYVLEEAENAAVTLIGVGAELSFALEVAN
KLKEKGVVARVVSFPCQRLFEQQSLEYKRSVLQRHRGIPAVVIEPYAPNGWERYADAGVC
IKRFGHSLPGKVAYKYFGYDIDTLTEKVHGYLGQVEKDELLKHEFVEL
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggctgttggtccggttactatcaacggcagcggcaaatctgccctgccgctggttcag
caaatgtccaaagaccatgacattgtgttgaagacattccgtatgctcatttcggactta
tgccagcagttcggaggaggtcaccctggtggcgccatcggtatggccgctatcggtgtc
gctctctggcgctatgtgatgcgctatgctcctcacacccccgatttcttcaaccgcgat
cgctttattctctcgaatggccatacctgtctattccagtactccttcctgcacttgacc
gggtacaaggctatgacctttgaccaactcaaatcctaccactcggatcgcgtcgatgca
ctttgtcctggccaccctgagatcgaacacgagggcatcgaagttactacaggacccctg
ggtcagggtgttgctaacgccgtcggtttggcgatggcgaccaagaacttggctgcgaag
ttcaatcaaccaggatacgatgttgtaaacaaccacacctggtgtatgattggagatgcg
tgtctacaggagggtgttggattggaagctatttcgtatgcgggtcatctgaagcttaac
aacctgactatcatctacgacaacaaccaaatcacctgtgatggatcagtcgatctgacc
aacactgaagacattaacggcaagatgcgcgcttctgggtgggacgtgattgacgtcgag
gacggttgctacgatgtcgagggtcttgtgcgggctctggaacaggctcgcgcctccaca
gagaagccaaccttcatcaacgtccgcacagtcattggccttggtagcaatgttgccggt
caggccgcagcccacggtgctgcattcggagctcccaacgtggcgcagatgaagaaggag
aacgggttcaacccggacgagcactttgttatcggagagacggtacggaagtttttcgaa
gatcttcctgcgcgtggtgaatctctcgtccaggaatggaaggaccttgtgaagcaatat
accgctcaataccctgagcttggcgcagaattccagcgccgcatgagcggagagttgccg
tccaactggaaggacctgatccctgccagcttcccagagaagcctaccgcttcacgagcc
tcgtctggcttggtcttcaaccccattgctaaggagattgagaacttcatggtcggcact
gctgacctctcgccctctgtaaacatgatctggcctggaaaggtagacttccaacaccct
gatctgcgcaccacttgcggcatcaacggcaactacggcggtcgctatatccactatggt
gtgcgtgaacacgccatgtgcgctatctctaacggcttggccgcctatgcccctaacacc
ttcatccccatcacctcatccttcttcatgttctacctctacgctgctcccgctgtgcgc
atgggcgcattgcagcacctccagatcatccacgccgccacacacgactccatcggtatg
ggtgaggatggcccgacccatcagcctatcgaactggccgcattataccgtgccatgcca
aaccttctctatatccgcccgggtgatagcgaagaaaccgccggtgcctggatcgccgcc
atcgaagccaagaagacacccaccatcatctccacttcccgtcacactctgccccaattg
aagcaaacctctcgcgacggtgtcgcgcgcggtgcatatgtcctcgaagaggccgagaat
gcagctgttaccctcattggtgtgggtgcagaattgtccttcgccctggaggtcgccaac
aagctcaaggagaagggcgtcgtcgcgcgggtggtcagtttcccttgccagcgtttgttc
gagcaacaatccctcgaatacaagcgctctgttctgcagaggcaccgtggtattcctgct
gttgttatcgagccttatgcacctaacggctgggagcgatatgcggacgctggcgtctgc
attaagcgctttggtcacagtttgcctggcaaggtggcgtacaagtacttcggttatgac
attgataccttgaccgagaaggttcacggttatctgggacaggttgagaaggatgaactc
ttgaagcatgagtttgttgagctgtga

DBGET integrated database retrieval system