KEGG   Aspergillus flavus: AFLA_111350
Entry
AFLA_111350       CDS       T01090                                 

Definition
(RefSeq) C-14 sterol reductase, putative
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
afv  Aspergillus flavus
Pathway
afv00100  Steroid biosynthesis
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
Module
afv_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    AFLA_111350
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     AFLA_111350
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 7915704
NCBI-ProteinID: XP_002377004
UniProt: B8N9I9
Position
Unknown
AA seq 483 aa
MPSHTESKYEFGGPLGAAAITVGLPILLYVFAFTCNDVTGCPVPSLLSPRTLSWGRLKSE
IGWPLGGIWGLYSWEVTGVVLAYYLLSMFLWKILPAQEVRGTKLVQHDRPLTYRFNSFSS
SVVQLAACAIGTYLKGADFVVWTYIADNYVQLLTANILISYALSAFVYVRSFSVDTNYPN
KELRELAAGGNTGNSVYDFYIGRELNPRVSLPIFGEFDIKTWCEMRPGLTGWILLNLAFI
AKQYRTYGFISDSILFTASVQAFYVLDGQYNESGILTMIDITTDGFGFMLSFGDLVWVPF
LYSTQCRYLAVYPLHLGWTGIAAVSAVFALGLYIFRAANTQKNVFRTQPSDPSVANMPYI
QTKRGTRLLTAGWWGMSRHINYFGDWLQSMPFSLPTGLAGYTIMSAGSAAALSTDFKMLD
GREVVQGEAKGWGAIFTYFYVLYFAILLMHRERRDDAMCAKKYGEDWEEYRRIVKWRILP
WVY
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgccctctcatactgaatcaaagtatgagtttggtggacctttgggtgctgctgccatc
accgtgggcctccccattctgctctatgtctttgcctttacatgcaacgatgtaactggc
tgtccagtaccatcactactaagccctcgtaccctgagctgggggaggctaaaatccgag
attggatggcctcttgggggcatctggggtctttacagttgggaggtgacgggggtggtg
cttgcatattacctcctcagcatgttcctctggaagattctccctgcacaagaagtgcgt
ggcacaaagttggttcaacacgatcggccgttgacataccgctttaactctttctcgtct
agcgttgttcagctagctgcatgcgccattggaacatatctcaagggtgcagactttgtt
gtctggacgtacatcgcggacaattatgtgcagctattgaccgccaacattctgatatca
tacgccctttccgcgtttgtatacgtacgcagcttcagcgtggacaccaattatccaaac
aaggagcttcgtgagttagctgctggtggaaacactggtaattctgtatacgatttttat
atcggtcgtgagctgaaccctcgtgtgtctctcccaatcttcggcgaatttgacatcaaa
acctggtgcgagatgcgccccggcctgactgggtggatattgctcaacttagcatttatt
gccaagcaataccgcacctatggcttcatctccgatagtatcctcttcactgcttccgta
caagcattctacgttcttgacggacagtataacgaatccggcattcttaccatgattgac
attaccacggatggctttgggttcatgttgtctttcggagatcttgtttgggtaccattt
ctctactcaacccagtgccgatacctcgcagtctaccccttgcacctcggatggaccggt
atcgccgccgtaagtgcagtcttcgcactcggcctgtacattttccgcgctgccaacacg
cagaagaacgttttccgcacgcagcctagtgatccaagtgtggcaaacatgccgtacatt
caaaccaaacgaggaacaagactgctgacggcaggatggtggggcatgtctcgccatatc
aattactttggggactggctgcaatccatgccctttagtttgccgacaggactggcaggc
tatactatcatgtctgctggcagtgccgcagccttatcaacggacttcaagatgcttgat
gggcgggaggttgttcagggtgaggccaagggctggggggccattttcacgtacttttat
gtgctctactttgccatcctcttgatgcatcgtgaacggagagatgatgctatgtgtgcg
aagaaatacggagaagactgggaggaatacaggaggattgtgaagtggagaattctgcct
tgggtctactag

DBGET integrated database retrieval system