KEGG   Aspergillus flavus: AFLA_114280Help
Entry
AFLA_114280       CDS       T01090                                 

Definition
(RefSeq) pyrroline-5-carboxylate reductase, putative
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
afv  Aspergillus flavus
Pathway
afv00330  Arginine and proline metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
afv01230  Biosynthesis of amino acids
Module
afv_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AFLA_114280
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     AFLA_114280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored PDH
Motif
Other DBs
NCBI-GeneID: 7909431
NCBI-ProteinID: XP_002385481
UniProt: B8NYR6
Position
Unknown
AA seq 278 aa AA seqDB search
MVLGHIGKALLGGLLPCAAQPGSPVSEITVALRRKESEARLRDLFHSSLAPVNFISGQNI
NAVKNADAVLFAFPPEQVHEVLGATKMRQALRGKIIISILARTPRDELERLIGGNDKADG
LVTNDIRLVRAMPTIGTEVHESATLIGDLSSPVEKEAMELAMWMFNLVGKVFEVSHDYFD
TATGMSAFCNALTTVAIQTITRKAIAEGIPMENAIAIASQCIRGTVSMVLSGASPQKLEH
SLSAPGSITEQAILGLRDSQLLALLESSLSAAITKAKG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggttttaggccatatcggtaaagccctacttggaggtttacttccatgtgcggcgcaa
cctggcagtcctgtttccgagatcactgttgctctcaggcgtaaagaatccgaagcgcgg
cttcgagacctcttccacagcagtctggctccggtgaacttcatctccggtcaaaatatc
aatgcagtgaagaatgcagacgcagttctttttgcctttcccccggaacaggtacatgaa
gtccttggggcaaccaaaatgcggcaagccttgagaggcaaaattatcatcagcattctc
gcgaggacgcctcgagatgaactcgaacgattaatcggaggcaatgacaaggccgatggt
ctcgtgacgaatgacatccgactcgttcgtgcaatgccgactataggaaccgaggtccac
gaatcagcgactctcatcggcgatctcagtagccctgtggagaaagaggcaatggaattg
gcgatgtggatgttcaatttagtcgggaaggttttcgaagtctcgcatgattattttgac
accgcaacaggtatgagtgcattttgcaacgcgctcacaaccgtggcaatacaaaccata
acgcgaaaggctattgctgagggtattccaatggagaacgccattgcaatagcctcccaa
tgcattcgaggaacggtgagcatggtcttgtccggagccagtcctcagaaattggagcat
tcattatctgcaccggggagcataaccgagcaggcgatattaggactcagagacagtcag
ctgctggctcttcttgagtcttcgctctctgcggctattacgaaggcaaaaggttga

DBGET integrated database retrieval system