KEGG   Aspergillus flavus: AFLA_114920Help
Entry
AFLA_114920       CDS       T01090                                 

Definition
(RefSeq) histone deacetylase HosB
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AFLA_114920
Chromosome and associated proteins [BR:afv03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     AFLA_114920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C INSC_LBD
Motif
Other DBs
NCBI-GeneID: 7909490
NCBI-ProteinID: XP_002385545
UniProt: B8NYY0
Position
Unknown
AA seq 1111 aa AA seqDB search
MDPSKRDDDPPAASFTPTSTSDALASPTTTNDPVDRSHRLNNVSMLATPLPVSPSGFSSS
SLLSPADAPARSTSPQAHTAPRRISSSNSLRDEHRSSSLKKRSSTASLRSVRNDSRTSTS
PHRSVSQHSSSSLSSSPTATTPTTLSNPNMLSKKSRLTKANELPTPTAASIATDHFQREV
ELHHSADLQSQTLVVIHDACYGHRFSRPRASRAALGSIVERPERIQASVLGVSAAYVRLT
HRYEGGRFAPHPDMNLDELPVPPFQICRTARSMALSSPAVTHVHGSRWMDDLKTMCDAAE
SRLALNGKELVRPPSAGKDGATETAPSLHEGDLYLCSESLNAFEGALGGVCEGVDAVFGP
RSTKRAFVCIRPPGHHCSSDHPSGFCWINNVHVGISYAAMTHGLTHAAILDFDLHHGDGS
QEIAWEQNRKATAAPRSAANYKKTAIGYFSLHDINSYPCEMGEPEKVRNASVCIDKAHGQ
SVWNVHLEQWKTEAEFWDLYASKYAVLIEKARAFLRFHTERLASTPNGPPPVAAIFISAG
FDASEWEGAGMQRHKVNVPTEFYAKFTADVVRMAEEEGLGVGGRIVSVLEGGYSNRALTT
GVLSHLSGLGDATSCLVSGGVDDTADRLTAEMTNRLGLLDISANVQHASSLPAYDSGWWS
PALLEELEALVYPPPAVKPREKSTPTYFAPTQSFTAKVVTTPRDRRSTGSQISVETDAPP
LPPVSWATATHELSRILIPSHRQTTSCRPEDLNAEATRLRRERQTAAQHTSVRSAGNEES
RMKLRARKPKTPLPETPNKETSKRQAIKSNRRTTIERASDLPDPSFDKSPNTRSTTRRKS
AASTITSTPENKAPGDKTVRSASAASTRRPGSSRSATPKRASSPKTAPPVPRVPSVYTNL
SAGEEAVITPVESRSLSRGTPDTPQDDLDSLTAGVRKLNIKLKVPSPEEHAARERERERQ
TSKRVSKTPIPSKKSSGTKGLNAPANKMAAHSNTALVRPDAENPITSLPTATGVVAEGSD
IHGGAILDRSTVMSTAVPSQALPLQTSISPPVTPGATYDSTHPQHALYSPPISEPSVKAG
IPVFISNSPIPFAPASAHHATAPSTSRESPP
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atggacccctccaagcgcgacgacgatcctccagctgcatcattcactcccacttccacc
tcggacgcactcgcgtcgccaacaaccaccaacgatcctgtagaccgttcgcatcgcttg
aataatgtgtcaatgctggcgacacctctcccggtctctccctccgggttttcctcttct
tctctcttatccccggcagatgcccccgcgcgctctacatcgcctcaggcgcatacagcc
cctcggcgcatctccagttctaactccctgcgcgatgaacatcgaagctccagcctaaag
aagcgctcatccaccgcgtcgctgcgatctgttcgcaacgacagcagaacctcaacatcc
cctcaccgtagtgtatcgcaacactcatcgtcgtcactttcaagctctcctaccgccacc
acaccaaccactctaagtaatcccaacatgctgtcaaaaaagtcgcgtcttaccaaagca
aatgagcttcctacacccacagctgcctctatcgcgacggatcatttccaaagagaggta
gagctgcaccactccgctgacctgcagtctcaaactcttgtggtgatccatgatgcctgt
tatggccatcgcttctcacgtccccgcgcctccagggcagctctcggctcgatcgtcgaa
agacccgagcgtatccaagctagtgtcctgggcgtgtctgcagcttatgtgcgtcttact
caccggtatgaagggggtaggttcgctccccacccagatatgaacttggacgagcttccc
gtaccaccgtttcagatctgcagaacggcacggtcgatggcgctcagctccccagcagtg
acccatgtacatggttccaggtggatggacgatctgaaaactatgtgcgacgcagcggaa
tcgcgacttgcattgaacggcaaagagttggtccgacccccgagtgcaggtaaggacggc
gccacagaaaccgcgccttcacttcatgaaggcgacctttatctgtgctcggagtccttg
aacgcattcgagggagccttgggtggtgtctgcgagggcgtggacgccgtctttggtccc
agatcgacaaagcgcgcgttcgtgtgcatccgcccccccggccaccattgctcttcggac
catccgtcggggttttgctggattaacaatgttcatgtaggtatctcctatgctgctatg
acccacggtttgactcacgccgccatcctggactttgacctacaccacggcgacggttcg
caggaaatcgcatgggagcagaaccgcaaggctactgcagctccccggagtgcagcaaac
tacaagaagaccgctattgggtacttcagtcttcatgatatcaactcgtatccttgcgaa
atgggggagccggaaaaagtgcgcaatgcaagtgtgtgtattgataaagcacatggtcag
tcagtttggaacgtccatctggagcagtggaagaccgaagcggaattttgggacctttac
gcatccaagtatgcggtactgatcgaaaaggcacgtgccttcctacgctttcacactgag
cgccttgctagtactcccaatggacctccgcctgttgcagctatctttatctctgcgggc
tttgacgcaagtgaatgggaaggggcaggaatgcaaaggcacaaggtgaatgtgcctacc
gaattctacgccaagtttaccgcagatgtcgtacgaatggcagaagaagaaggtctgggt
gttggtggaaggatcgttagcgttttggaaggagggtacagtaatcgcgctctgacaacg
ggtgttttaagccatttgtcggggctaggggatgcgacctcgtgtctggtgtctggcggg
gtggatgacacggccgatcgtttaactgctgagatgacgaatcgcttgggcctgcttgac
atctcagctaatgtccaacacgcatcaagcctgccggcttatgacagcgggtggtggtcg
ccagctctgctagaggaactagaggcattagtatatccaccgccagcagtgaaacctcgt
gagaagtctacaccaacctactttgctccgacccagtcatttaccgctaaagtggtcact
acgcctcgtgatcgacgatctaccggctcccagatcagcgtggaaactgatgcgccgcca
ttgccgcctgttagttgggctaccgcaacgcatgaactttcaagaattcttatcccaagt
catcggcaaaccacaagctgtcgaccagaagatctcaacgcagaagccacacgtttgcga
cgggaacgtcaaacggccgcccagcacaccagcgtccgctcggctgggaatgaagaaagt
cggatgaaactccgtgcgaggaaacccaagactccattacccgaaaccccgaacaaagaa
acttcaaagcggcaggccatcaaaagcaaccgaagaactaccatcgaacgtgccagtgac
ctacccgatccgtccttcgataagtctcctaacacacgcagcacaacccgtagaaagagt
gccgcttccacgataacatcaaccccggaaaacaaagccccaggcgataaaactgttcgc
tcggcgtcagcagccagcacgcgcaggcccggtagctctcggtctgcgactcctaagcgc
gcctcgagccccaaaacggcacctcctgtgcctcgggtcccgtccgtatacaccaatttg
tctgcaggtgaagaagcggtgatcacaccagttgaatcacgctcgttatcgaggggcacg
ccagatacaccgcaagatgatttggatagtctgacagcaggtgttcgaaaactcaacatc
aaactgaaagtaccgtcacctgaggaacatgccgcccgggaaagggaacgcgagcgacaa
acttctaagagggtgtccaagacacctattccctccaaaaagtcctcgggcacgaaggga
ctgaatgctcccgcgaataagatggcagctcattcaaacacggctcttgtaagacccgat
gcagagaatcctatcacatcgttacccacggctaccggtgtggtggccgaaggatccgac
atccatggtggggctatcctggatagatccacggtaatgtctacggcggttccatcacag
gcacttcctctacagacgtcaatctcaccccctgttacgccgggagccacgtatgatagt
acgcaccctcaacatgccttgtactctccaccgatatctgagccctctgtcaaagcaggc
attccggtgtttatatctaacagccctattccttttgcaccagcaagtgctcaccacgcg
accgctccaagcacgagcagagagtcacctccttaa

DBGET integrated database retrieval system