KEGG   Aspergillus flavus: AFLA_129370Help
Entry
AFLA_129370       CDS       T01090                                 

Definition
(RefSeq) cytochrome B5, putative
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
afv  Aspergillus flavus
Pathway
afv00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFLA_129370
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AFLA_129370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 Cyt-b5 NAD_binding_6 FAD_binding_9 TPR_18
Motif
Other DBs
NCBI-GeneID: 7911542
NCBI-ProteinID: XP_002382130
UniProt: B8NNN6
Position
Unknown
AA seq 474 aa AA seqDB search
MPSFTLEQVQKHCKPDDVWFVLHNKVYDVTKYLEDHPGGNAILLEVAGTDATEAFEEVGH
SDEAREQLEPFYVGDLPTEEHTESVEIYRPTYEQVSQSAAVNVKTSTSWSSIIQTIIKCA
MTGLAGKSAITVYRRGITTTEIAHALRSLTTSISPRQGPGHDGSHFWAGVGIASAVQFSL
TLGLGMWISTKLDVQQEFTHHVPRRPAKPARMIRLSRTNIPIKKPSVLDPRKWRSFTLTS
KTEVAPHVYRFIFALPNPDDVLGLPTGQHIALRATINGQSVSRSYTPVSNNSDLGRIELL
IKVYPNGAMTQHLEQMKVGDSIKIRGPKGAMQYSRQYAKHIGMIAGGTGITPMYQLIRAI
CEDDSDKTQVSLLYANNTEEDILLRTELDNFARYHPEKFQVQYVLSHPGETWQGYQGFVN
GDLIAKHLAPAALENKVLLCGPPPMVAAMKKTLQGMGWTIPGAVAKAGDQVFLF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccttcacccttgaacaggtccaaaaacactgcaaaccggacgatgtctggttt
gtcctccacaacaaggtctacgatgtgaccaaatatcttgaggatcaccccggtgggaat
gccattcttcttgaggtcgctggcaccgatgctacagaagctttcgaggaagtcggacac
tctgacgaagcccgggaacagttagagcctttctacgtaggcgacttaccgacagaggaa
catactgaatctgtcgagatctaccgcccaacatacgaacaagtctcacaatctgcggct
gtcaacgtcaaaacctccacctcctggtcatccataatccaaacaatcataaaatgcgcc
atgaccggtctagcaggcaaatccgccataacagtctaccgccgtggcataaccaccacc
gagatagctcacgctctgcgctccctcaccacatccatctctccccgccagggcccgggc
cacgacggatcccatttctgggccggcgtaggcatcgccagtgcagtccagttctcccta
accctgggcctgggaatgtggatttcgaccaagctagacgtgcagcaagaattcacccat
cacgttccccgtcggccagccaaaccagcacgtatgatccgactctcccggaccaatatt
ccaatcaagaaaccgagtgtcctggatccgcgcaaatggcgatcattcaccttgaccagc
aaaactgaagtcgcaccacatgtatatcgattcatctttgcgctgccaaatccggatgat
gtcctcggcctaccgacgggccaacacattgctctacgagcaacgatcaacggacaaagc
gtctcgagatcgtacacaccggtatccaacaacagcgacctaggtcgcatcgagctactc
atcaaagtataccccaacggagcgatgacccagcatttagagcagatgaaagtaggcgac
tcaatcaagatccgcgggcccaagggcgcaatgcaatattcccggcaatatgcgaagcac
atcgggatgatcgcaggtggaacaggaattacaccaatgtaccagctcattcgggcaatc
tgcgaagatgacagcgacaagacgcaggtgtcactgctgtacgcgaataacacggaagag
gacattctgctgcgcacggagctagataacttcgcgaggtatcatcctgaaaaattccag
gtgcagtatgtgctgagccaccccggggagacgtggcagggttatcaggggtttgtgaat
ggggatcttattgcgaagcatttggcgcctgctgcgctggagaataaagtgttgctgtgc
gggccgccgccgatggtggcggcgatgaagaagaccctgcaagggatgggatggacgata
cctggggctgttgctaaggctggggatcaggttttcttgttttag

DBGET integrated database retrieval system