KEGG   Aspergillus flavus: AFLA_135670Help
Entry
AFLA_135670       CDS       T01090                                 

Definition
(RefSeq) translocation protein Sec62, putative
  KO
K12275  translocation protein SEC62
Organism
afv  Aspergillus flavus
Pathway
afv03060  Protein export
afv04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    AFLA_135670
   04141 Protein processing in endoplasmic reticulum
    AFLA_135670
Secretion system [BR:afv02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   AFLA_135670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec62 DUF3619
Motif
Other DBs
NCBI-GeneID: 7915939
NCBI-ProteinID: XP_002379580
UniProt: B8NHG2
Position
Unknown
AA seq 401 aa AA seqDB search
MAAPGQPSPQQIAAMQQQFAAEAARRGMTPEEFAKQQREQLNAEAAKHGMSTEQYVQQLR
MRALAAHQKQVEAQRQGQGSPQPGQPGQPGQQGQQDEQGQQTPQQPQPQQTTHQVPVNPS
NPPDPKAIAVAQFLRSQNLKPRTCIMDGQRKDMFKVKRAIRALESPAYAKAAAKKNSLLP
PVTDRASAENVFKLLPLSLLALRVSKVDPHAGHNHAKPKNRVKGLWTVKIEQHQETDPMM
HYVWLYEGPQWKQKAMAAAVVAGIFAVVLFPLWPMVMRQGVWYLSVGMMGLLGLFFAMSI
FRLILFCVTVFAVPPGLWLFPNLFEDVGFIDSFKPLWGWQESKKKKKSKKSSGDASKSAK
SPVSQPADSAPSATTTATAAPDTSSAVKRDLAPRVEEVTDE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccggccagccgtctccccagcagattgccgccatgcagcaacagttcgct
gctgaggccgcaaggcgtggtatgactccggaggaattcgctaaacaacagcgcgaacag
ctgaatgctgaagctgcgaagcatggcatgtccacggagcaatacgtccaacaactgaga
atgcgagctctcgctgctcaccagaagcaggtcgaggcccaacgacagggccaaggatcg
ccacagccaggacagccaggacaaccaggccagcaaggccagcaagacgagcaaggccag
cagacaccacaacagcctcaaccacaacagactacgcatcaagtccctgtgaacccatcg
aatcccccagaccctaaagccatcgcggttgcgcagttcttgcgatctcagaacctgaag
ccgagaacgtgtatcatggatggacagaggaaggacatgttcaaagtgaaacgtgccatt
cgcgctctggagtcgcccgcgtacgctaaagcagccgcaaagaagaactctttactccct
cccgtaacggaccgtgcatcagcagagaatgttttcaagctcctccccctatcgcttctt
gccttgcgcgtgtcgaaagtcgatccccacgcgggtcacaaccacgcgaagcccaagaac
cgagtcaaggggctgtggaccgtcaagattgagcaacaccaggaaacagaccctatgatg
cactacgtatggctatatgagggtccgcaatggaaacagaaggctatggccgccgcagtg
gtggctggtattttcgccgttgttctcttcccattgtggcccatggtgatgagacagggt
gtttggtacctgagtgttggtatgatgggtctactggggttattcttcgccatgtcgatc
ttccgtcttattctgttttgcgtcacggtctttgctgtccctcctggtctctggttgttc
ccgaacttgttcgaggatgttggcttcattgacagcttcaagcccttgtggggttggcaa
gagagtaagaaaaagaagaagtctaagaagtcttccggcgacgcatccaagtccgccaag
tctcccgtctctcaaccagccgactctgccccttcagcgaccacaacggcaaccgcggcc
ccggatacttcaagtgccgtgaagcgcgatctggcccctcgagttgaggaggtgacagac
gagtaa

DBGET integrated database retrieval system