KEGG   Aspergillus flavus: AFLA_139410Help
Entry
AFLA_139410       CDS       T01090                                 

Definition
(RefSeq) aflC / pksA / pksL1 / polyketide synthase
  KO
K15316  noranthrone synthase [EC:2.3.1.221]
Organism
afv  Aspergillus flavus
Pathway
afv00254  Aflatoxin biosynthesis
afv01100  Metabolic pathways
afv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AFLA_139410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:afv01008]
    AFLA_139410
Enzymes [BR:afv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.221  noranthrone synthase
     AFLA_139410
Polyketide biosynthesis proteins [BR:afv01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal nonreducing PKS (NR-PKS)
    AFLA_139410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt SAT Thioesterase Acyl_transf_1 Ketoacyl-synt_C PS-DH PP-binding KAsynt_C_assoc Abhydrolase_6 Thiolase_N
Motif
Other DBs
NCBI-GeneID: 7914331
NCBI-ProteinID: XP_002379951
UniProt: B8NI04
Position
Unknown
AA seq 2109 aa AA seqDB search
MAQSRQLFLFGDQTADFVPKLRSLLSVQDSPILAAFLDQSHYVVRAQMLQSMNTIDHKLA
RTADLRQMVQKYVDGKLTPAFRTALVCLCQLGCFIREYEESGNMYPQPSDSYVLGFCMGS
LAAVAVSCSRSLSELLPIAVQTVLIAFRLGLCALEMRDRVDGCSDDRGDPWSTIVWGLDP
QQARDQIEVFCQTTNAPQTRRPWISCISKNAITLSGSPSTLRAFCEMPQMAQHRTALIPI
CLPAHNGALFTQADITTILDTTPTTPWEQLPGQIPYISHVTGNVVQTTNYRDLIEVALSE
TLLEQVRLDLVETGLPRLLQSRQVKSVTIVPFLTRMNETMSNILPVSFISTETRTDTGRA
IPASGRPGAGKCKLAIVSMSGRFPESPTTESFWDLLYKGLDVCKEVPRRRWDINTHVDPS
GKARNKGATKWGCWLDFSGEFDPRFFGISPKEAPQMDPAQRMALMSTYEAMERAGLVPDT
TPSTQRDRIGVFHGVTSNDWMETNTAQNIDTYFITGGNRGFIPGRINFCFEFAGPSYTND
TACSSSLAAIHLACNSLWRGDCDTAVAGGTNMIYTPDGHTGLDKGFFLSRTGNCKPYDDK
ADGYCRAEGVGTVFIKRLEDALADNDPILGVILDAKTNHSAMSESMTRPHVGAQIDNMTA
ALNTTGLHPNDFSYIEMHGTGTQVGDAVEMESVLSVFAPSETARKADQPLFVGSAKANVG
HGEGVSGVTSLIKVLMMMQHDTIPPHCGIKPGSKINRNFPDLGARNVHIAFEPKPWPRTH
TPRRVLINNFSAAGGNTALILEDAPERHWPTEKDPRSSHIVALSAHVGASMKTNLERLHQ
YLLKNPHTDLAQLSYTTTARRWHYLHRVSVTGASVEEVTRKLEMAIQNGDGVSRPKSKPK
ILFAFTGQGSQYATMGKQVYDAYPSFREDLEKFDRLAQSHGFPSFLHVCTSPKGDVEEMA
PVVVQLAITCLQMALTNLMTYFGIRADVTVGHSLGEFAALYAAGVLSASDVVYLVGQRAE
LLQERCQRGTHAMLAVKATPEALSQWIRDHDCEVACINGPEDTVLSGTTKNVAEVQRAMT
DNGIKCTLLKLPFAFHSAQVQPILDDFEALAQGATFAKPQLPILSPLLRTEIHEQGVVTP
SYVAQHCRHTVDMAQALRSAREKGLIDDKTLVIELGPKPLISGMVKMTLGDKISTLPTLA
PNKAIWPSLQKILTSVYTGGWDINWKNYHAPFASSQKVVDLPSYGWDLKDYYIPYQGDWC
LHRHQQDCKCAAPGHEIKTADYQVPPESTPHRPSKLDPSKEAFPEIKTTTTLHRVVEETT
KPLGATLVVETDISRKDVNGLARGHLVDGIPLCTPSFYADIAMQVGQYSMQRLRAGHPGA
GAIDGLVDVSDMVVDKALVPHGKGPQLLRTTLTMEWPPKAAATTRSAKVKFATYFADGKL
DTEHASCTVRFTSDAQLKSLRRSVSEYKTHIRQLHDGHAKGQFMRYNRKTGYKLMSSMAR
FNPDYMLLDYLVLNEAENEAASGVDFSLGSSEGTFAAHPAHVDAITQVAGFAMNANDNVD
IEKQVYVNHGWDSFQIYQPLDNSKSYQVYTKMCQAKENDLVHGDVVVLDGEQIVAFFRGL
TLRSVPRGALRVVLQTTVKKADRQLGFKTMPSPPPPTTTMPISPYKPANTQVSSQAIPAE
ATHSHTPQQPKHSPVPETAGSAPAAKGVGVSNEKLDAVMRVVSEESGIALEELTDDSNFA
DMGIDSLSSMVIGSRFREDLGLDLGPEFSLFIDCTTVRALEDFMLGSGDAGSGSNVEDPP
PSATPAINPEIDWSSSASDSIFASEDHGHSSESGADTGSPPALDLKPYCRPSTSVVLQGL
PMVARKTLFMLPDGGGSAFSYASLPRLKSDTAVVGLNCPYARDPENMNCTHGAMIESFCN
EIRRRQPRGPYHLGGWSSGGAFAYVVAEALVNQGEEVHSLIIIDAPIPQAMEQLPRAFYE
HCNSIGLFATQPGASPDGSTEPPSYLIPHFIAVVDVMLDYKLAPLHARRMPKVGIVWAAD
TVMDERDAPKMKGMHFMIQKRTEFGPDGWDTIMPGASFDIVRADGANHFTLMQKEHVSII
SDLIDRVMD
NT seq 6330 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatcaaggcaactctttctcttcggcgatcagacagcggattttgttcccaag
ctccgcagtttactatccgtccaggacagccctattctagccgcctttcttgaccagtcc
cactatgtcgtgcgagcccagatgctgcagagcatgaacacgattgatcacaagttggct
cgaaccgctgacctgcgccaaatggtccagaagtatgtcgacggcaaactgaccccggca
tttcgaaccgctctagtgtgcctctgccagttgggatgcttcatccgggaatatgaggaa
tctggcaacatgtacccacagcccagtgacagctacgtgctgggattctgcatgggttcc
ttggccgctgtggcggtaagctgcagtcgctccttgtcagagctgctgcctatcgctgta
caaactgtgttgattgccttccgcctcggtctttgcgccctggagatgcgggatcgggtg
gatgggtgtagcgatgatcgaggtgacccttggtctaccattgtttggggtctggatccc
cagcaagctcgtgatcagattgaagtgttctgtcagaccacaaacgcacctcagacgagg
cgcccgtggatcagctgcatctctaagaatgccatcaccctaagtggcagtccatccact
ttgagggcgttctgtgagatgcctcagatggcccagcaccggactgccctaattcccatc
tgtttaccggcccacaatggcgccctcttcacgcaggcagatatcactaccatactagac
acgacgcctaccactccttgggagcaactgcccggccaaataccttatatttcccatgtc
acggggaatgtagtccagactaccaactaccgggaccttatagaggtagccttgtctgag
actctcttggagcaagtgcgactagacttggttgagactggactgccacgccttttgcaa
tctcgtcaggtcaagagcgtcaccatcgtcccattcttgactcgcatgaatgagacaatg
agcaacattctcccagtcagctttatcagtacagagacaaggactgacaccggacgagcc
atcccagcttcaggtcgaccaggcgcaggcaagtgcaagctggctattgtgtccatgtcg
gggaggttccctgaatcaccgaccaccgaaagcttttgggaccttttatacaaagggttg
gatgtttgtaaagaggttccccgtcgacggtgggacatcaacacgcatgtggatcccagc
gggaaagcacgaaacaaaggggctaccaaatggggctgttggctggatttctcaggcgag
tttgatccccgattctttgggatctcgcccaaagaggcgccacagatggatccagctcag
cgcatggccttgatgtctacttacgaggcaatggagcgggctggtttggttcccgacacc
acgccgtcgacccagcgagaccgcattggggtcttccacggagtcaccagtaacgactgg
atggagaccaatacagcccagaacattgacacatacttcatcaccggtggaaaccggggg
tttattcccgggcgcattaacttctgtttcgaatttgccggacccagctataccaatgac
acggcctgttcatccagtctagctgccatccacctggcctgcaattctctctggcggggc
gactgtgacacggcggtggcaggaggaactaacatgatctatactcctgatggtcacaca
ggattggacaaagggttctttctttcccggactggcaactgcaaaccctacgacgacaag
gccgatggttactgccgagctgagggggtcgggacggtgttcatcaaacggctggaagat
gccctggcagataatgaccccatcctcggcgttattctagatgctaaaactaatcactca
gccatgtcggagtcgatgactcggccgcacgtgggcgcccaaatcgataacatgacggcg
gcgctgaataccactggactccaccccaatgactttagctacattgagatgcatggcact
ggcacccaggtaggggatgcggtggagatggagtcagtcctgtcggtgtttgcgccgtcc
gaaaccgccagaaaggcggatcagccactatttgtcggctcagccaaggccaacgtagga
catggagagggagtgtctggggttacgagccttattaaggttctgatgatgatgcagcac
gataccatacctcctcactgcggcatcaaaccgggcagcaaaatcaaccgcaacttccct
gatcttggagctcgcaatgtgcacatcgcctttgaacccaagccctggccacgcacacac
actccgcgcagggtgcttatcaacaacttcagtgccgcgggagggaatactgccttgata
ttggaagacgctccggagcgtcactggccgacagagaaggatccgcgctctagtcatatc
gtcgccctgtctgcgcatgtgggggcttccatgaaaaccaacctcgaacgactgcatcag
tatctcctgaaaaacccccacactgatctcgcgcagctgtcatatactactactgcgcgt
cgatggcattatttacaccgagtgagcgtcactggcgcgtctgttgaagaagtgactcgc
aagctagagatggccatacagaacggggacggagtcagtcgacctaaaagcaagccgaag
attctctttgctttcacgggacaagggtctcaatatgcaactatgggtaagcaggtgtac
gatgcgtatccatctttcagagaggacctggagaagtttgatcggttggcgcaaagtcat
ggcttccctagttttcttcacgtctgtacttcacctaaaggggatgtggaagagatggct
cccgttgtggtgcaactggctatcacttgcctccaaatggcccttactaacctcatgacc
tacttcgggatccgtgccgatgtgacagtggggcatagtttgggtgaatttgcagccctg
tatgcggcgggagttctttcggcctcagacgtcgtttacctggttggtcaaagagcggag
ctactccaggagcgctgccaacgcgggacgcatgccatgctggctgtaaaagctacccct
gaagcgttgtcccaatggatccgggatcatgactgtgaggtagcctgtattaatggccct
gaagataccgttctcagtggcaccactaagaatgttgccgaggttcaacgcgctatgacg
gacaacgggatcaaatgcacgctgttgaaactgccgtttgccttccattctgcccaggtg
caacctattctggatgactttgaggccctggctcagggagcgacatttgccaagcctcaa
ctaccaattctctctcccttgctgcgaacagaaatccacgaacaaggcgtcgtgactcca
tcatatgtcgcgcaacattgtcgtcacaccgtagatatggcccaagctttgagatctgct
cgagaaaagggactcatcgacgacaaaaccctcgtcattgagctgggaccgaagccatta
atctcgggcatggtgaaaatgacactgggagacaaaattagcaccttacccactctagca
cctaacaaggccatttggcccagcctgcagaagattctcacctcggtctacacgggtggg
tgggatattaattggaagaattatcacgcccctttcgcctcctcccagaaggtggtggat
ctgccgagctacggctgggatttgaaggactactacatcccgtatcagggtgactggtgt
ctgcatcgccaccagcaggattgtaagtgcgccgctcctggccacgaaatcaaaacggcc
gactaccaagtgcctcctgagtcgacgcctcaccgtccatccaagctggaccctagcaag
gaggccttccccgaaatcaagaccaccacgacactccatcgagtggtagaagagacgacc
aaacctttgggcgccaccctagttgtggagacagacatatctcggaaggatgttaacggc
ctcgctcgagggcaccttgtcgatgggatccctttgtgtaccccttccttttatgctgac
atcgccatgcaagtgggccaatatagtatgcaacggctccgtgcgggacatccgggggcc
ggtgccatagatggccttgtggacgtgtccgacatggtggtggacaaagcgttagttccc
catgggaagggacctcaattgctgcgcacgacgcttaccatggagtggccgcccaaggct
gctgctactacgcgaagcgccaaagtcaaattcgccacctattttgccgatgggaagctc
gatacggagcatgccagctgtactgtcagattcacaagcgatgcacagttgaaatctcta
cgccggtctgtgtctgagtacaagacccacattcgtcagttacatgatggccatgctaag
ggacagttcatgcgatacaataggaagaccgggtacaagctcatgagcagcatggctcgg
tttaatcccgactacatgctcctagattatctggtgctgaacgaagcagagaacgaggca
gcaagtggtgtagacttctcgttgggatcgtcggaaggcaccttcgcagctcacccagct
cacgtcgatgccatcacccaggtggccggttttgctatgaatgccaatgacaatgtcgac
attgagaaacaggtctacgtcaatcacggttgggactcgttccagatctaccaaccgcta
gataatagcaagtcttaccaggtctacaccaagatgtgtcaagcgaaggagaatgatttg
gtgcatggcgatgtggtagttctggacggagaacaaatcgttgctttcttccgcggcctt
acgctgcgatcagttcctcgtggtgcactgcgtgtcgtcctgcagactacagtgaaaaag
gccgatcgccaactaggatttaagacaatgccgtcgccgccgcccccgacgacgacaatg
ccaatatcgccttataaaccagctaatactcaggtttccagccaagctattccagcagag
gccactcattctcacaccccgcaacagccaaagcattccccggtaccggaaactgccgga
agcgctccagcggcaaaaggagttggtgtcagtaacgaaaagttagatgctgtaatgcga
gtcgtttcggaggagagtggaattgccctcgaggagctcaccgatgacagcaactttgct
gacatgggcatcgactctctcagttcaatggtcattgggagccgcttcagagaggacctg
gggctggacctggggcctgagttttctcttttcattgactgcactaccgtgcgtgccttg
gaagacttcatgttgggaagcggggatgctggcagtggctccaatgtagaagatcctccc
ccatcagctactcccgccatcaaccccgaaatcgattggtctagcagtgcctccgatagt
atttttgccagcgaagatcacggtcattcgagtgagtccggcgccgacaccggaagtccg
cctgcacttgacctgaagccctactgccgcccctcaacttctgtcgtcctacaaggtcta
cctatggtggcgcggaaaactctgtttatgctccctgatggcggagggtctgcgttctcc
tacgcctccctgccgcgcctcaaatcagatactgccgttgtgggcctgaattgcccttat
gctcgggatcccgagaacatgaactgcacacatggagctatgattgagagcttttgcaat
gagatccggcggcgacagccacggggcccctatcacctgggcggctggtcgtccggtggt
gcattcgcttacgtcgtggccgaggcacttgttaaccaaggcgaggaggtgcattcgtta
atcatcattgatgcgcctattccccaagccatggaacaacttccccgagcattttacgag
cactgcaatagcattggattgttcgctacccagccgggggctagtccggacggctcgact
gagcctccgtcctacttaatcccacactttatcgctgtggtggatgtgatgctggattac
aagctggccccgttgcatgcgcgccggatgcccaaagtcggcatcgtctgggcggcagat
acagtcatggacgagcgggacgctcccaagatgaaaggaatgcattttatgattcagaag
cggacggaatttggtcccgatgggtgggatacgatcatgcccggggcctcgtttgacatt
gtccgagcagacggtgctaatcattttacgttgatgcaaaaggaacatgtctctataatt
agcgatctgatcgaccgggtcatggattag

DBGET integrated database retrieval system