KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0064Help
Entry
Anae109_0064      CDS       T00559                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00071  Fatty acid degradation
afw00072  Synthesis and degradation of ketone bodies
afw00280  Valine, leucine and isoleucine degradation
afw00310  Lysine degradation
afw00362  Benzoate degradation
afw00380  Tryptophan metabolism
afw00620  Pyruvate metabolism
afw00630  Glyoxylate and dicarboxylate metabolism
afw00640  Propanoate metabolism
afw00650  Butanoate metabolism
afw00900  Terpenoid backbone biosynthesis
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
afw01200  Carbon metabolism
afw01212  Fatty acid metabolism
afw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:afw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Anae109_0064
   00630 Glyoxylate and dicarboxylate metabolism
    Anae109_0064
   00640 Propanoate metabolism
    Anae109_0064
   00650 Butanoate metabolism
    Anae109_0064
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Anae109_0064
   00072 Synthesis and degradation of ketone bodies
    Anae109_0064
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Anae109_0064
   00310 Lysine degradation
    Anae109_0064
   00380 Tryptophan metabolism
    Anae109_0064
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Anae109_0064
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Anae109_0064
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Anae109_0064
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afw04147]
    Anae109_0064
Enzymes [BR:afw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Anae109_0064
Exosome [BR:afw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Anae109_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Dodecin ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABS24284
UniProt: A7H6D8
Position
80530..81738
Genome map
AA seq 402 aa AA seqDB search
MKRAGQKDVVILAAKRTPFGTFGGALKDHSATDLAVHAAGAAIAQAGVPAEDYGHVVMGN
VVQTSPDAIYLARHVGLRAGLPQRVAALTVNRLCGSGFEAIIQAARLIELGEAELVLAGG
TESMSQAPLVVRGTRFGYAFGKPPAMEDMLWSAVTDSYAGMPMALTAEKLAEQYALSQDE
VDDYSVLSQRRWAAAHEAGRFREELAPLELKGRKGPVAFERDEHPRPDTTVEGLRTLPKA
FKKDGVIHAGAASGIADGAGALVVATREYAERRGVKPIARVVNWGHAGVDPTVMGIGPVP
AIRNALERAGATLADVDLFEVNEAFAPQYLAVEKELGLPRERTNVDGGAIAVGHPLGASG
ARITMHLAYELRRRGGRAAVGAACIGGGQGVAIVLAPAEPGA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggcaggccagaaggacgtcgtcattctcgccgccaagcggacccccttcggg
acgttcggcggcgccctcaaggaccacagcgccaccgatctggccgtgcacgccgccggc
gccgcgatcgcgcaggccggcgtccccgccgaggactacgggcacgtggtgatggggaac
gtcgtgcagacgagccccgacgccatctacctcgcccgccacgtggggctgcgcgccggg
ctgccgcagcgcgtggcggcgctcaccgtgaaccggctctgcggctccgggttcgaggcg
atcatccaggcggccaggctcatcgagctgggcgaggcggagctggtcctcgccggcggg
acggagtcgatgagccaggcgccgctcgtggtgcgcggcacgcgcttcggctacgccttc
gggaagccgcctgcgatggaggacatgctctggtcggccgtcacggacagctacgcgggc
atgcccatggcgctcaccgcggagaagctggccgagcaatacgccctctcgcaggacgag
gtggacgactactcggtgctctcccagcgacgctgggcggcggcccacgaggcggggcgc
ttccgcgaggagctggcgcccctcgagctgaagggcaggaaggggccggtcgccttcgag
cgcgacgagcacccccggcccgacaccaccgtcgagggcctccgcacgctccccaaggcc
ttcaagaaggacggggtgatccacgcgggcgcggcgagcggcatcgcggacggggccggc
gcgctggtcgtcgccacccgcgagtacgcggagcgacgcggggtgaagcccatcgcgcgg
gtggtgaactggggccacgccggcgtggaccccacggtcatgggcatcggtccggtgccc
gccatccgcaacgcgctcgagcgcgccggcgcgaccctcgcggacgtggacctgttcgag
gtgaacgaggccttcgccccgcagtacctcgcggtggagaaggagctcgggctgccgcgc
gagcgcaccaacgtggacggcggcgccatcgccgtggggcacccgctcggcgcgagcggg
gcgcgcatcaccatgcacctcgcgtacgagctccgccgtcgcggcggccgggcggcggtg
ggcgccgcctgcatcgggggcggccagggcgtcgccatcgtcctcgcgccggccgagccc
ggcgcatga

DBGET integrated database retrieval system