KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0396Help
Entry
Anae109_0396      CDS       T00559                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
afw  Anaeromyxobacter sp. Fw109-5
Brite
KEGG Orthology (KO) [BR:afw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Anae109_0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ABS24611
UniProt: A7H7B5
Position
complement(450073..450447)
Genome map
AA seq 124 aa AA seqDB search
MSTAVTQGIRVEVRSAYRPDRSEAGRWLFTYTVRIANQGETPALLAARHWIITDANGERE
EVVGEGVIGQQPQLSPGDEFEYTSFCVLETPHGSMQGSYRMERPDGSSFHARIAPFPLVA
GTLN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaccgccgtcacccagggcatccgcgtcgaggtgcgcagcgcctaccgtccggac
cgttccgaggccggccgctggctcttcacctataccgtccgcatcgccaaccagggggag
acgccggcgctgctcgcggcgcgccactggatcatcaccgacgcgaacggcgagcgcgag
gaggtggtcggcgagggcgtcatcggccagcagccgcagctctcccccggcgacgagttc
gagtacacgagcttctgcgtcctggagacgccgcacggctcgatgcagggcagctaccgc
atggagcggcccgacggctcgtccttccacgcgcggatcgcgccgttcccgctggtggcg
gggacgctgaactga

DBGET integrated database retrieval system