KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1129Help
Entry
Anae109_1129      CDS       T00559                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00860  Porphyrin and chlorophyll metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Anae109_1129
Enzymes [BR:afw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Anae109_1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ABS25337
UniProt: A7H9E1
Position
1280792..1282174
Genome map
AA seq 460 aa AA seqDB search
MIQIPSWELIKKYDRPGPRYTSYPTAPEWSDAFGPKDYEEHLARADAEGGPLSIYVHLPF
CREMCRFCGCNVIATHDRTRAESYLELLEKEVELVAKRLPRRRTVTQLHWGGGTPTFLDE
RQLEQCHALLARHFDFAKDGEKAIEIDPAITTRSQIETLARLGFNRISMGVQDFDPHVQE
TVGRIQGVKETAELVQAARDAGFHGVNLDLIYGLPFQSRDTWQKTLDLILQIHPDRLAVF
GFAYVPWSKPHQRLLPQEALPKTEQRVELFLQAVEAFTSGGYRLIGLDHFALESDELTRA
QDAGYLYRNFQGYTVRPAADTVAFGMTSISDIGGAYAQNAHKLKDWGEKVAQGVIPVERG
ASVTADDVMRRFVINRVMCLLKLDLREVAEKFGPAARKTIEADLAKGVEELQGDGLVTFD
GELLRVTPLGQLLVRNVAMLFDAYLGKHAGEKRPTFSRTV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgatccagatcccgtcctgggagctcatcaagaagtacgatcgccccggcccgcgctac
accagctaccccaccgcgccggagtggtcggacgccttcgggccgaaggactacgaggag
cacctcgcgcgcgcggacgcggagggcgggccgctctcgatctacgtccacctcccgttc
tgccgcgagatgtgccgcttctgcggctgcaacgtcatcgcgacgcacgaccggacccgc
gccgagtcctacctcgagctcctcgagaaggaggtcgagctcgtcgcgaagcgcctgccc
cggcgccgcaccgtcacgcagctccactggggcggcgggacgcccaccttcctcgacgag
cggcagctcgagcagtgccacgccctcctggcgcgccacttcgacttcgcgaaggacggc
gagaaggccatcgagatcgaccccgccatcaccacgcgctcgcagatcgagacgctggcg
aggctcggcttcaaccggatctcgatgggggtgcaggacttcgatccccacgtccaggag
acggtcggccgcatccagggcgtgaaggagaccgccgagctcgtgcaggcggcgcgcgac
gccggcttccacggggtgaacctcgacctcatctacgggctgcccttccagtcccgggac
acctggcagaagaccctcgacctcatcctgcagatccaccccgatcgcctggcggtgttc
gggttcgcgtacgtcccgtggtcgaagccgcaccagcggctcctcccgcaggaggcgctc
cccaagaccgagcagcgcgtcgagctgttcctgcaggcggtggaggcgttcacctcgggc
ggctaccgcctcatcgggctcgaccacttcgcgctcgagtcggacgagctcacccgcgcg
caggacgccggctacctgtaccggaacttccaggggtacacggtgcggccggcggcggac
accgtcgcgttcgggatgacgtcgatctcggacatcggcggcgcttacgcccagaacgcg
cacaagctcaaggactggggcgagaaggtcgcccagggcgtcatccccgtggagcgcggc
gcctcggtcaccgccgacgacgtcatgcgccgcttcgtcatcaaccgggtcatgtgcctg
ctcaagctcgacctgcgcgaggtcgccgagaagttcggcccggccgctcgcaagacgatc
gaggctgacctcgcgaagggcgtggaggagctgcagggcgacgggctcgtcacgttcgac
ggcgagctgctgcgggtcacgcccctcggccagctcctcgtgaggaacgtggccatgctg
ttcgacgcgtacctcgggaagcacgccggcgagaagcggcccaccttctcgcggacggtc
tag

DBGET integrated database retrieval system