KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1428Help
Entry
Anae109_1428      CDS       T00559                                 

Definition
(GenBank) Aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00350  Tyrosine metabolism
afw00360  Phenylalanine metabolism
afw00380  Tryptophan metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Anae109_1428
   00360 Phenylalanine metabolism
    Anae109_1428
   00380 Tryptophan metabolism
    Anae109_1428
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afw04147]
    Anae109_1428
Enzymes [BR:afw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Anae109_1428
    4.1.1.105  L-tryptophan decarboxylase
     Anae109_1428
Exosome [BR:afw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Anae109_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABS25635
UniProt: A7HA89
Position
1616092..1617522
Genome map
AA seq 476 aa AA seqDB search
MGQTPRMTPEEFRRLGHALVDWIAAYRDRLPTLPVMSQVEPGAIRARFPEEPPAEGGRLA
EAVAALDDAVLPGITHWNHPGFFAYFPSNTSLASVLGDLVAAGLGAQGMSWQTSPAATEV
EEVVMGWLRRMIGLPPAFAGVVQDTASTATFTALLCARERTSGFSQNGAGLQGGGAPLVV
YASDQAHSSIEKGALLAGFGKAHLRLVPTDDAHALRLDLLGRAIADDLAAGLRPCALVAA
TGTTATTALDPVAGMADLAERHGLWLHVDAALAGTAMVLPECRWMWAGVERADSVVFNPH
KWMGIGFDFSAYFVRDPQHLVRVMSTNPSYLRTAHDAVVNNFRDWGIPLGRRFRALKGWF
HLVDEGVAAMQARLRRDLANAAWLKEQVDAAPGWERLAPVPLQTVCLRHVPAGVADERAL
AEHNLAIARRVNEGGRAYVTPSVLKGRQMIRVSVGAAATERPDVERVWRELREAAG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggggcagactccgcggatgacccccgaagagtttcggcgcctcggccacgcgctcgtc
gactggatcgccgcgtaccgggatcgcctccccacgctgccggtgatgagccaggtcgag
cccggcgccatccgggcgcgcttccccgaggagccgcccgcggagggcggccggctcgcc
gaggcggtcgccgcgctcgacgacgcggtcctccccggcatcacgcactggaaccacccc
ggcttcttcgcctacttcccctcgaacacgagcctcgcctcggtgctcggcgacctcgtc
gccgccgggctgggggcgcaggggatgagctggcagacctcgcccgccgcgaccgaggtc
gaggaggtggtgatgggctggctccggcggatgatcgggctaccgcccgcgttcgcgggg
gtcgtgcaggacaccgcctcgaccgcgacgttcaccgccctgctgtgcgcccgcgagcgg
acgagcggcttctcccagaacggcgcgggcctgcaggggggcggggcgcccctcgtcgtc
tacgcctcggaccaggcgcacagctcgatcgagaagggcgcgctcctcgccggcttcggg
aaggcccacctgcggctcgttccgacggacgacgcgcacgcgctccggctcgacctcctg
gggcgcgccatcgccgacgacctcgccgcgggccttcgcccgtgcgcgctggtcgcggcc
acgggcaccaccgccacgaccgccctcgatccggtggccgggatggcggacctcgccgag
cgccacgggctgtggctgcacgtcgacgccgcgctcgccgggaccgcgatggtgctgccg
gagtgccgctggatgtgggccggcgtggagcgggcggactcggtggtcttcaacccgcac
aagtggatggggatcggcttcgacttcagcgcctacttcgtgcgcgacccgcagcacctc
gtgcgcgtcatgagcacgaacccgtcctacctgcgcaccgcccacgacgccgtggtcaac
aacttccgggactggggcatcccgctcggccgccgcttccgggcgctgaaaggctggttc
cacctcgtcgacgagggcgtcgcggcgatgcaggcgcgcctccgccgcgacctcgcgaac
gcggcgtggctgaaggagcaggtggacgcggcgcccggctgggagcggctcgcgccggtg
ccgctccagaccgtctgcctgcgccacgtgcccgccggcgtcgccgacgagcgcgccctc
gcggagcacaacctcgccatcgcgcggcgggtgaacgagggcggccgggcgtacgtgacg
ccgagcgtcctcaaggggcgccagatgatccgcgtgtccgtcggcgcggcggccacggag
cgccccgacgtcgagcgggtgtggagggagctgcgggaggcggcggggtag

DBGET integrated database retrieval system