KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1587Help
Entry
Anae109_1587      CDS       T00559                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00630  Glyoxylate and dicarboxylate metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01200  Carbon metabolism
Module
afw_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Anae109_1587
Enzymes [BR:afw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Anae109_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase SelB-wing_2
Motif
Other DBs
NCBI-ProteinID: ABS25791
UniProt: A7HAP5
Position
complement(1784613..1786865)
Genome map
AA seq 750 aa AA seqDB search
MDFEKEVEEVRRWFASPRFAGIRRVHSAREVVEQRGTIRPDYAVARGAAEAFYDRLRQLF
EQQRCVTTFGPYSPGQAVAIKKMGIEAIYLGGWATSAKGSSHEDPGPDLASYPLSQVPEE
AATLVRALLTADKNQLHTRARMTEEQRRATPEVDFRPFIIADADTGHGGDAHVRNLIRRF
VEVGVPGYHIEDQKPGVKKCGHQGGKVLVSEDEQLKRLSAARFQLDIMGVPGIIVARTDA
ESATLLDGRGDDRDQPFILGVRNLSLPTFKAAFLAMLRQFQRAGVEELSGHELYALCDEE
LAAADAWLAGAGFDAAIAAAAAELHRGALRGVDAALDKVFDAFVDAWQQEAGVSTYAEAV
GEAIGFREHEGDPAAMGKAEWLAFAERAPFYKARQRARAIGLDVTWDCEHAKTPDGYYQV
RGGIDYAIAKSLAAAPFADLLWMETKTADLHDAKRFADAVHAAYPDKMLAYNLSPSFNWD
TTGMDDEQMRRFPEELGKLGFVFNFITYGGHQIDGLAAEEFATALRQDGMLALARLQRKF
RLLESGYRTPQTLVGGPRADAGLMSISGRTSTTKAMGQGSTQVQHLVQTEVPPRLLEEWV
DAWREHHAIPGKLRATLRPHTGESDLLELALTSADGEKKLNVIFASIHDRRGRSILSVRD
QNNFDARLRQKRLMTLALLFLFHRYKVDSVHFVTPTADNQRQAEGMKAQGLFGTVVQEVG
RIIVADVAKDRVKELLAPDRAALKALIARQ
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgagaaggaggtcgaggaggtccggcgctggttcgcgagcccccgcttcgcg
ggcatccggcgggtccactcggcccgcgaggtggtcgagcagcgcggcaccatccgcccg
gactatgccgtcgcgcgcggcgccgcggaggccttctacgaccggctgcgccagctgttc
gagcagcagcgctgcgtcacgaccttcggcccctactcccccggccaggcggtggcgatc
aagaagatgggcatcgaggccatctacctgggcggctgggccacctccgccaagggctct
tcgcacgaggacccggggcccgacctcgccagctacccgctgagccaggtgcccgaggag
gcggcgaccctcgtccgcgccctgctcaccgccgacaagaaccagctccacacgcgcgcg
cgcatgacggaggagcagcgccgggccacgcccgaggtggacttccgcccgttcatcatc
gccgacgccgacacgggccacggcggcgacgcgcacgtccgcaacctcatccggcgcttc
gtcgaggtgggcgtgcccggataccacatcgaggaccagaagcccggcgtgaagaagtgc
ggccaccagggcggcaaggtgctcgtctccgaggacgagcagctgaagcgactctccgcg
gcgcgcttccagctcgacatcatgggcgtgccgggcatcatcgtggcccgcaccgacgcc
gagtcggcgacgctgctcgacggtcgcggcgacgaccgcgaccagccgttcatcctcggc
gtgcggaacctctcgctgcccacgttcaaggcggcgttcctcgcgatgctgcggcagttc
cagcgcgccggggtggaggagctctcggggcacgagctctacgcgctctgcgacgaggag
ctcgcggccgccgacgcctggctcgccggggcgggcttcgacgcggccatcgccgccgcc
gccgcggagctccaccgcggcgccctgcgcggcgtcgacgccgccctcgacaaggtgttc
gacgcgttcgtggacgcctggcagcaggaggcgggggtctccacctacgccgaggcggtg
ggcgaggccatcggcttccgcgagcacgagggcgacccggccgcgatgggcaaggcggag
tggctggcgttcgccgagcgggcgccgttctacaaggcgaggcagagggcgcgcgcgatc
ggcctcgacgtcacgtgggactgcgagcacgcgaagacgcccgacggctactaccaggtg
cgagggggcatcgactacgccatcgccaagtcgctggcggcggcgccgttcgccgacctg
ctctggatggagaccaagaccgccgacctccacgacgcgaagcggttcgccgacgccgtc
cacgccgcctaccccgacaagatgctggcctacaacctgtcgccctcgttcaactgggac
accacggggatggacgacgagcagatgcgccgcttcccggaggagctcgggaagctgggc
ttcgtgttcaacttcatcacctacgggggccaccagatcgacggcctcgccgcggaggag
ttcgccaccgcgctccgccaggacggcatgctcgcgctggcgcgcctccagcggaagttc
cgcctgctcgagtctgggtaccgcacgccgcagacgctggtcggcggcccgcgcgccgac
gccgggctcatgtccatctccggacgcacctccaccaccaaggcgatgggccagggctcg
acgcaggtccagcacctcgtgcagaccgaggtgccgccgaggctgctcgaggagtgggtg
gacgcctggcgcgagcatcacgcgatcccgggcaagctgcgggcgacgctgcggccgcac
accggcgagtccgacctgctcgagctggcgctcacgtccgccgacggggagaagaagctg
aacgtcatcttcgccagcatccacgaccggcgcgggcgcagcatcctctcggtgcgcgac
cagaacaacttcgacgcgcgcctgcgccagaagcggctcatgaccctggcgctgctgttc
ctcttccaccgctacaaggtggactcggtgcacttcgtcacgccgaccgcggacaaccag
cggcaggcggaggggatgaaggcgcagggcctcttcggcaccgtggtgcaggaggtgggg
cggatcatcgtcgccgacgtggccaaggaccgggtgaaggagctgctcgcgccggaccgg
gcggcgctgaaggcgctcatcgcgaggcaatag

DBGET integrated database retrieval system