KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1995Help
Entry
Anae109_1995      CDS       T00559                                 

Definition
(GenBank) dehydrogenase complex catalytic domain
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00010  Glycolysis / Gluconeogenesis
afw00020  Citrate cycle (TCA cycle)
afw00620  Pyruvate metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
afw01200  Carbon metabolism
Module
afw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_1995
   00020 Citrate cycle (TCA cycle)
    Anae109_1995
   00620 Pyruvate metabolism
    Anae109_1995
Enzymes [BR:afw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Anae109_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABS26198
UniProt: A7HBV2
Position
2259036..2260400
Genome map
AA seq 454 aa AA seqDB search
MAYKLELPDIGEGVVEAEVQQWFVKPGDDVAEDQPLVEVMTDKATVVIPSPKRGRVVKLF
FGVGDLAKVHSPLLELELEGAVAGAPEGPEGPRAKATVEAPSVASAPTPSGQRGAAPPEL
AEARPAGAGGEGPPRASGQKSLATPAVRALARELEIDINAVAGSGAGGRVTKDDLAAYRR
GTNGHGRPELRAAPAGELAPASRAPAAPPSPIPLRPESGGAADERVPLRGVRKRIAENMA
RSKRTAAHFTFVEQCDVTELARVKERMAVAAKEEGVKLTFLPFVVKAVVAALRKHPKLNA
TMDDERGELVLHRRYDVGIASATDAGLVVPVVRGADRRSLVELAREIERLAQDAKAGRAR
PEDMGRSTFTITSLGALGGMFATPVLNYPEVGILGVHRIRPTPVVRDGQVVVRDVMHVSV
TSDHRVVDGHEAAAFCYEVIRTLEDPNLLFMHLA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacaagctcgagctccccgacatcggcgagggcgtcgtcgaggccgaggtccag
cagtggttcgtgaagcccggcgacgacgtcgccgaggaccagccgctcgtcgaggtgatg
accgacaaggcgacggtcgtcatcccatcgccgaagcgcgggcgcgtcgtgaagctgttc
ttcggcgtgggcgacctggccaaggtgcactcgcccctcctcgagctggagctggagggg
gcggtcgcgggggcgccggaggggccggaggggccgcgcgcgaaggcgaccgtcgaggcg
ccctcggtggcgagcgcccccacgccgtcgggccagcgcggtgccgctcccccggagctt
gccgaggcgcggccggcgggcgccggcggggaggggcctccccgcgcctccggccagaag
tcgctcgcgacgccggcggtgcgcgcgctcgcgcgggagctcgagatcgacatcaacgcc
gtggcgggctcgggtgccggcgggcgcgtgacgaaggacgatctcgccgcgtaccggaga
ggcacgaacgggcacggacggccggagctgcgggccgcgccggcgggcgagctcgcgccc
gcctcccgcgcccccgcggcgccgccgtcgcccatcccgctccggccggagtcgggcggc
gcggccgacgagcgggtcccgctgcgtggcgtccgcaagcgcatcgccgagaacatggcc
cgctccaagcggaccgccgcgcacttcaccttcgtcgagcagtgcgacgtgacggagctc
gcgcgggtgaaggagcggatggcggtcgccgcgaaggaggagggggtgaagctcaccttc
ctcccgttcgtcgtgaaggccgtggtcgccgcgctccgcaagcacccgaagctgaacgcg
acgatggacgacgagcggggcgagctggtgctgcatcgccgctacgacgtcggcatcgcc
tccgccaccgacgcagggctggtcgtgccggtggtgcgcggcgcggaccggcgctcgctc
gtcgagctcgcccgcgagatcgagcggctcgcccaggacgcgaaggccggccgcgcgcgg
cccgaggacatgggccgctcgaccttcaccatcacgagcctcggcgcgctcggcgggatg
ttcgcgacgccggtgctcaactaccccgaggtcggcatcctcggggtgcaccggatccgg
cccacgccggtggtgcgcgacgggcaggtggtcgtgcgagacgtcatgcacgtgtccgtc
acgagcgaccaccgcgtcgtcgacgggcacgaggcggcggcgttctgctacgaggtcatc
cggacgctcgaggatccgaacctgctcttcatgcacctggcgtag

DBGET integrated database retrieval system