KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2075Help
Entry
Anae109_2075      CDS       T00559                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Brite
Enzymes [BR:afw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Anae109_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD Methyltransf_11 Methyltransf_23 NodS Methyltransf_12 Methyltransf_32 CMAS
Motif
Other DBs
NCBI-ProteinID: ABS26278
UniProt: A7HC32
Position
2355588..2356226
Genome map
AA seq 212 aa AA seqDB search
MVRWSVSAELSRAVAAMGIRDPAVLRAIAEVPRDLFVPPRLRHQAGADQALPIGFGQTIS
QPFVVAFMTERLHLTGLERVLEVGTGSGYQTAILARLAAEVFSIEIVPELAARARAALLE
TLHLRNVRLRTGDGAAGWPEAAPFDRVLVTAAAPEVPPALTAQLAPGGRMVVPVGAAPGL
QVLRAVDKGNDGVDLSTDLIPVRFVPLTGASG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ttggtacgatggagcgtgagcgccgagctgtcgcgcgcggtggcggcgatggggatccgc
gatccggcggtcctccgggccatcgcggaggtgccgcgtgacctgttcgtgccgccgcgc
ctgcgtcaccaggccggcgcggaccaggctctccccatcggcttcggccagaccatctcg
cagccgttcgtggtcgcgttcatgaccgagcggctgcacctgaccggcctcgagcgcgtg
ctggaggtcgggacgggctcggggtaccagaccgcgatcctcgcccggctggcggcggag
gtcttctccatcgagatagtcccggagctcgccgcgcgcgcccgcgcggcgctgctcgag
acgcttcacctgcggaacgtgcggctgcggacgggcgacggcgccgcaggctggcccgag
gcggcgccgttcgatcgcgtcctcgtcaccgccgcggcgcccgaggtcccgccggcgctc
accgcgcagctcgcgccgggcgggcggatggtggtgccggtgggcgccgcgcccgggctg
caggtgctgcgcgccgtcgacaaggggaacgacggcgtggacctctcgaccgacctcatc
ccggtgcgcttcgttccgctcaccggggcgagcggctag

DBGET integrated database retrieval system