KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2078Help
Entry
Anae109_2078      CDS       T00559                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00260  Glycine, serine and threonine metabolism
afw00750  Vitamin B6 metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01230  Biosynthesis of amino acids
Module
afw_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Anae109_2078
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Anae109_2078
Enzymes [BR:afw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Anae109_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABS26281
UniProt: A7HC35
Position
2358141..2359499
Genome map
AA seq 452 aa AA seqDB search
MTAPAPSAWFRCAEGCDFRAELVDVVYECPRCGGLLEVEHDRAALAARSGDEWRALFDGR
FKLGAWPYGSGVWGKKEWVYPQLATENVVSMYEGGSPLLRVDRYARELGLEDVWVKECGV
THTGSFKDLGMTVLVSAVKEMRARGREVRAVACASTGDTSAALSAYCAAAGIPSVVLLPR
GKISTAQLVQPISNGALVLELDTDFDGCMRVVRDLARTKDIYLANSMNSLRIEGQKTASI
EIAQQLGWTTPDWIVIPGGNLGNASAVGKGFQLMKELGLVDRLPRLVVAQAAQANPLWKA
TSGAGVKPTTAVTVEPVPAQRTLASAIQIGAPVSARRALRALEALDGVVEQATEQELADA
AARADRAGLFTCPHTGVALAALEKLAARGAVRRGERVVVISTAHGLKFSDFKVGYHDGTL
PGIASPLRNPGVRLPATLGAVQDAIAARFGRG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcccgcaccctcggcctggttccgctgcgcggaaggctgcgacttccgggcg
gagctcgtcgacgtcgtctacgagtgcccccgctgcggcgggctgctcgaggtcgagcac
gaccgcgccgcgctcgccgcgcgctccggcgacgagtggagggcgctgttcgacggccgc
ttcaagctcggggcctggccgtacggctcaggggtgtggggcaagaaggagtgggtctac
ccccagctcgcgaccgagaacgtggtctccatgtacgagggcggcagcccgctcctccgg
gtggatcgctacgcgcgcgagctcggcctcgaggacgtgtgggtgaaggagtgtggcgtc
acgcacaccgggtcgttcaaggacctgggcatgacggtgctcgtctccgcggtgaaggag
atgcgcgcgcgcggccgtgaggtgcgggccgtcgcctgcgcctccacgggcgacacctcc
gccgcgctcagcgcctactgcgccgccgccggcatcccgagcgtggtgctcctgccgcgc
ggcaagatctcgacggcccagctcgtccagcccatctcgaacggtgcgctcgtcctcgag
ctcgacaccgacttcgacggctgcatgcgcgtcgtgcgggacctcgcgcgcacgaaggac
atctacctcgcgaactcgatgaactccctgcgcatcgaggggcagaagaccgcctccatc
gagatcgcgcagcagctgggctggaccacgccggactggatcgtcatcccgggcgggaac
ctggggaacgcgagcgccgtggggaagggcttccagctcatgaaggagctggggctggtc
gaccggctgccacggctcgtggtcgcccaggcggcgcaggcgaaccccctctggaaggcc
accagcggcgctggggtcaagcccaccacggcggtgacggtcgagcccgtcccggcgcag
cggacgctcgcgtcggcgatccagatcggcgcgccggtctcggcccggcgcgccctgcgc
gcgctcgaggcgctcgacggcgtcgtcgagcaggccaccgagcaggagctcgcggacgcc
gccgcgcgggcagatcgcgccggcctcttcacctgtccgcacacgggcgtcgccctcgcg
gccctcgagaagctcgcggcgcgcggcgccgtccgccgcggcgagcgggtggtggtgatc
tccaccgcgcacgggctcaagttctcggacttcaaggtcggttaccacgacgggacgttg
ccggggatcgcgtcgccgctgcggaacccgggggtccgcctgccggcgaccctcggcgcc
gtccaggacgcgattgccgcccgcttcgggcgggggtag

DBGET integrated database retrieval system