KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2397Help
Entry
Anae109_2397      CDS       T00559                                 

Definition
(GenBank) pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase family
  KO
K05396  D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00270  Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Anae109_2397
Enzymes [BR:afw01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Anae109_2397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF2868
Motif
Other DBs
NCBI-ProteinID: ABS26599
UniProt: A7HD03
Position
complement(2777229..2778242)
Genome map
AA seq 337 aa AA seqDB search
MAPLSVNRVPRVALACLPTPLERSPRLGRELGLELLYKRDDLTGLELSGNKARKLEYLLA
EAEETQADTLVTCGGVQSNHCRATAFAAAKRGLSAVVLLRVTDPSRPPPLEANALLDRLA
GAQIRWVSHDEYRRRGELMRSAADELRAAGRRPYVIPEGGSSELGSLGYVAAVAELRAQL
PDAWRSGPVTIAYAAGSGGTGAGIELGVRATGWEGARPLGFAVCNDAHYFRETIARICAD
AHRRWPELPAVPAEEISLDDGSIGPGYALATDDGLALIRRAARLDGVLLDPVYTGKAMLG
LARRASEPGGLPSSRVVFLHTGGAFGLFPFAQRLAGP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggccccgctctccgtgaaccgcgttccacgcgtcgcgctcgcctgcctgccgacgccg
ctcgagcgatcgccccgcctcggccgcgagctcggcctcgagctcctgtacaagcgggac
gacctcaccggcctcgagctgtccggcaacaaggcgcgcaagctcgagtacctgctggcg
gaagcggaggagacgcaggccgacacgctcgtcacctgtggtggcgtgcagtcgaaccac
tgccgcgcgaccgcgttcgcggcggcgaagcgcggcctctcggcggtggtgctgctgcgg
gtgacggatccctcgcggccgccgccgctcgaggcgaacgccctcctcgatcggctcgcg
ggcgcgcagatccgctgggtgtcccacgacgagtaccgccggcgcggcgagctcatgcgg
tcggccgccgacgagctgcgcgcggccggccggcgcccctacgtcatcccggagggaggg
tcgagcgagctcggtagcctggggtacgtggccgccgtggccgagctccgcgcgcagctg
ccggacgcctggcgcagcggacccgtgaccatcgcctacgcggccgggtcgggcgggacg
ggcgcggggatcgagctcggggtccgcgccaccgggtgggaaggggcgcggccgctcgga
ttcgcggtctgcaacgacgcgcactacttccgggagacgatcgcccggatctgcgcggac
gcccaccggcgctggcccgagctccccgccgtgccggcggaggagatctccctggacgac
ggctcgatcggtccggggtatgcgctcgcgaccgacgacggcctcgcgctcatccgccgc
gccgcgcggctcgacggcgtgctcctggatccggtctataccggcaaggcgatgctgggc
ctcgcgcgccgcgcgtccgagccgggcgggctgccctcgtcccgcgtcgtcttcctgcac
accggcggcgccttcggcctgttccccttcgcgcagcggctcgccggtccgtga

DBGET integrated database retrieval system