KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2506Help
Entry
Anae109_2506      CDS       T00559                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K16843  (S)-sulfolactate dehydrogenase [EC:1.1.1.310]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00270  Cysteine and methionine metabolism
afw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Anae109_2506
Enzymes [BR:afw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.310  (S)-sulfolactate dehydrogenase
     Anae109_2506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 ACT_6 F420_oxidored AdoHcyase_NAD IlvN ACT_7
Motif
Other DBs
NCBI-ProteinID: ABS26707
UniProt: A7HDB1
Position
complement(2903515..2905101)
Genome map
AA seq 528 aa AA seqDB search
MVARVLVSDDLSPEAVRILQEAGLEVDVKVGLKPDQLERIVGDYDGLAVRSATKVTAQLL
DKAARLKVIGRAGVGVDNVDLAAATRRGVVVMNTPGGSSITVAELALSMILALSRHVAAA
TGSVKAGKWEKKRFQGHELAGRTLGVVGIGNIGSVLVARAVALGMRVVAFDPFISAEAAA
KLGASLVDLDTLWREADVVSIHVPLTDKTRHLVDATALGKMKKGALLVNCARGGIVDERA
LADALRSGQLGGAGLDVFEQEPPPADHPLYGLENVILTPHIGASTEEAQSAVAVAVAEQL
ADYLVRGVVRNAVNAPGLPPEVMEQLAPYLPLAQKLGALAAQLAPQGPSEVTIEVAGELA
AVPIRPLAARTLVGMLGPVLDTPVNEVSAPAIARERGLVVREVRSAELHDYASLVTVTVR
GAVGQAEVAGTVYGKREARVVRVNAFRVEAVPDGNVLLCENDDAPGVVGNLGTTLAAAGV
NIAQISLSRLEDRSGAFAFLNVDSPPSAELLEKVRKLPHVRSARAIVL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgcgcgtactcgtgtcggacgacctgtcgccggaggcggtgcggatcctccag
gaggccgggctcgaggtggacgtgaaggtcgggctgaagcccgaccagctcgagcggatc
gtcggcgactacgacggcctcgccgtccgcagcgcgacgaaggtcaccgctcagctgctc
gacaaggcggcgcggctgaaggtgatcgggcgcgccggggtgggggtcgacaacgtcgac
ctcgccgcggccacgcgccgtggcgtcgtcgtgatgaacacgcccggcggctcgtccatc
accgtggcggagctcgcgctctccatgatcctcgcgctctcccgccacgtcgccgcggcg
acggggagcgtcaaggcgggcaagtgggagaagaagcggttccagggacacgagctcgcc
ggcaggacgctgggggtcgtcggcatcgggaacatcggctcggtgctggtcgcgcgcgcc
gtcgcgctggggatgcgcgtcgtcgccttcgacccgttcatctccgcggaggccgccgcg
aagctcggcgcgagcctcgtggatctcgacacgctctggcgcgaggccgacgtcgtctcc
atccacgtgccgctcacggacaagacccgccacctcgtggacgcgaccgccctcggcaag
atgaagaagggcgccctcctcgtgaactgcgcccggggcgggatcgtggacgagcgcgcc
ctcgcggacgcgctgcgctcggggcagctcgggggcgccgggctcgacgtgttcgagcag
gagccgccgcccgcggaccacccgctgtacgggctcgagaacgtcatcctgacgccgcac
atcggcgcctcgaccgaggaggcgcagtcggccgtcgccgtggcggtcgccgagcagctc
gccgactacctcgtgcgcggcgtcgtgcgcaacgcggtgaacgcgccggggctgccgccg
gaggtgatggagcagctcgcgccgtacctgcccctcgcgcagaagctcggcgcgctggcg
gcgcagctcgcgccgcaggggccgagcgaggtgaccatcgaggtggccggggagctggcg
gcggtgcccatccgcccgctcgcggcgcgcacgctcgtcgggatgctcgggccggtcctc
gacactccggtgaacgaggtgagcgcgccggccatcgcccgcgagcgaggcctggtggtg
cgcgaggtccgctccgccgagctccacgactacgcgagcctcgtcaccgtgaccgtgcgc
ggcgcggtcggccaggcggaggtcgccgggaccgtgtacgggaagcgcgaggcgcgggtg
gtgcgcgtgaacgcgttccgcgtcgaggccgtcccggacgggaacgtgctcctctgcgag
aacgacgacgcgccgggggtggtggggaacctcgggacgacgctcgccgcggcgggcgtg
aacatcgcgcagatctcgctctcgcgcctggaggaccgctcgggcgcgttcgccttcctg
aacgtcgactcgccgccctcggccgagctcctggagaaggtgcgcaagctgccgcacgtc
cgctccgcgcgggcgatcgtcctgtga

DBGET integrated database retrieval system