KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2729Help
Entry
Anae109_2729      CDS       T00559                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00740  Riboflavin metabolism
afw00790  Folate biosynthesis
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Anae109_2729
   00790 Folate biosynthesis
    Anae109_2729
Enzymes [BR:afw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Anae109_2729
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Anae109_2729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ABS26930
UniProt: A7HDY4
Position
complement(3164869..3166146)
Genome map
AA seq 425 aa AA seqDB search
MKDHAAHAVERVERAIAHIRAGKMVILTDDEDRENEGDLCMAAEKVTPAAVNFMAKYGRG
LICLSLTEDKVRTLRLPLMVDESANSSSYGTAFTVSIEAKEGVTTGISAKDRAHTILTAV
RDDARPDDLARPGHVFPLRARKGGVLVRAGQTEGSVDLARLAGMKPAGVICEVMNDDGTM
ARMPELERLSAEHDLPLVSVADLISYRMLKDTLVHRAAQAPLPTEYGEFRAVAYENEVDR
HQHVALVKGKWREGEPVMVRVHSKCLTGDVFGSERCDCGPQLQAALRQIERAGKGVLLYL
DQEGRGIGLANKLKAYNLQDEGYDTAEANVRLGFKPDLRDYGIGAQILRDLGVRKMRLLT
NNPKKIIGLEGYGLEVVERVPIEMPATRRNRAYLITKRDKMGHLLTLAPAAPARRTASRA
KGRKR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggaccacgcggcgcacgccgtggagcgcgtggagcgggcgatcgcccacatccgc
gccggcaagatggtgatcctcaccgacgacgaggatcgcgagaacgagggcgacctctgc
atggcggcggagaaggtcacccccgccgccgtgaacttcatggcgaagtacgggcgcggc
ctcatctgcctctcgctcaccgaggacaaggtccgcacgctgcgcctgccgctcatggtg
gacgagagcgccaactcctcctcctacggcacggccttcacggtctcgatcgaggccaag
gagggcgtgaccaccgggatcagcgccaaggaccgcgcccacaccatcctcaccgcggtg
cgcgacgacgcgcgccccgacgatctcgcccggcccggccacgtcttcccgctccgcgcg
cgcaagggcggggtcctcgtgcgcgccggccagaccgagggctccgtcgatctcgcccgc
ctcgccggcatgaagccggccggcgtcatctgcgaggtgatgaacgacgacgggacgatg
gcgcggatgccggagctcgagcggctctccgccgagcacgacctccccctcgtctcggtc
gccgacctcatctcgtaccggatgctgaaggacaccctcgtccaccgggccgcgcaggcg
ccgctgcccacggagtacggggagttccgggcggtcgcgtacgagaacgaggtggaccgg
caccagcacgtcgcgctcgtgaaggggaagtggcgcgagggcgagccggtcatggtgcgc
gtccactcgaagtgcctcaccggggacgtgttcgggagcgagcgctgcgactgcggcccg
cagctccaggccgccctccgccagatcgagcgcgcgggcaagggcgtcctgctctacctc
gatcaggaggggcggggcatcggcctcgcgaacaagctgaaggcgtacaacctccaggac
gaggggtacgacacggccgaggcgaacgtgcggctcggcttcaagccggacctgcgcgac
tacgggatcggcgcgcagatcctccgcgacctcggggtccgcaagatgcggctgctcacc
aacaaccccaagaagatcatcgggctcgagggctacgggctcgaggtggtggagcgcgtg
ccgatcgagatgccggccacccgccgcaaccgcgcgtacctcatcaccaagcgggacaag
atgggccacctgctcacgctcgcgccggcggcgccggcgcggcggacggcgtcccgcgcg
aaaggaaggaagcgatga

DBGET integrated database retrieval system