KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3170Help
Entry
Anae109_3170      CDS       T00559                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00010  Glycolysis / Gluconeogenesis
afw00620  Pyruvate metabolism
afw00640  Propanoate metabolism
afw00680  Methane metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
afw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_3170
   00620 Pyruvate metabolism
    Anae109_3170
   00640 Propanoate metabolism
    Anae109_3170
  Energy metabolism
   00680 Methane metabolism
    Anae109_3170
Enzymes [BR:afw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Anae109_3170
Lipid biosynthesis proteins [BR:afw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Anae109_3170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: ABS27366
UniProt: A7HF70
Position
complement(3718497..3720200)
Genome map
AA seq 567 aa AA seqDB search
MMSPSRPFLEARDFLLAHRTDYAQAYLDFRWPRLERFNWALDHFDLLARGNERPALWLVD
GGGDELKLSFAELSRRSAQVANFLRENGVRRGDAVLMMLGNVVPLWEVMLACMKLGAVII
PATTLLTTDDLEDRFERGKVRHVIVGDTDAGKFDALPGDYTRIVVGRERPGWIAYDGARD
AAPEFTPDGPTAADDPLLLYFTSGTTAKPKLVLHTHTSYPVGHLSTMYWIGLMPGDVHYN
ISSPGWAKHAWSNVFAPWNAGATVFIYNQARFDAKATLDVVTRCGVTSLCAPPTVWRMLI
QEDLASYPVRLRELVGAGEPLNPEVIDQVEKAWGIVIRDGYGQTETTCQIGNSPGQKVKP
GSMGRPMPGYRVALLGDGERPAREGEICLSLEERPVGLMSGYRDDPAKTAHLLRNGHYHC
GDVASVDDEGYYTYVGRMDDVFKSSDYRISPFELESALIEHDAIAEAAVVPSPDPRRLTV
PKAFVVLRDGYEPSRELALSIFQHIRAVLAPYKRVRRIEIADLPKTISGKIRRTELSRLE
RQRHESPAARGEREFFEDDFPELKASP
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcccgtcacggcccttcctcgaagcgcgagacttcctcctcgcccaccggacc
gactacgcgcaggcctacctggacttccggtggccgcgcctggagcggttcaactgggcc
ctcgaccacttcgacctgctggcgagggggaacgagcgccccgcgctctggctcgtcgac
ggcggcggcgacgagctgaagctctccttcgccgagctctcccgccggtcggcccaggtc
gcgaacttcctccgggagaatggggtccggcggggcgacgcggtcctcatgatgctcggg
aacgtcgttccgctctgggaggtcatgctcgcctgcatgaagctcggcgcggtgatcatc
cccgccacgaccctcctcaccaccgacgacctcgaggaccgcttcgagcgaggcaaggtc
cggcacgtgatcgtcggcgacacggacgccggcaagttcgacgcgctcccgggcgactac
acgcggatcgtcgtcggccgcgagcgccccggctggatcgcctacgacggcgctcgcgac
gcggcgccggagttcactccggacgggcccaccgccgcggacgatccgctgctcctctac
ttcacctccggcacgacggcgaagccgaagctcgtgctccacacgcacacgagctatccg
gtcggtcacctctcgaccatgtactggatcgggctgatgcccggcgacgtgcactacaac
atcagctcgccgggctgggccaagcacgcctggagcaacgtcttcgcgccgtggaacgcg
ggcgcgacggtgttcatctacaaccaggcgcggttcgacgcgaaggcgacgctcgacgtc
gtcacgcgctgcggcgtcacctccctgtgcgccccgccgaccgtctggcggatgctcatc
caggaggatctggcgagctaccccgtgaggctccgcgagctcgtcggcgcgggcgagccg
ctcaacccggaggtgatcgaccaggtcgagaaggcgtggggcatcgtcatccgcgacggc
tacggccagaccgagacgacctgccagatcggcaactcgcccggacagaaggtgaagcca
ggatcgatggggcggccgatgcccggctaccgggtcgcgctgctcggcgacggggagcgg
cccgcacgcgagggcgagatctgcctgtcgctcgaggagcgcccggtcgggctcatgtcc
ggctaccgggacgacccggcgaagacggcgcacctgctgcgcaacggccactaccactgc
ggcgacgtcgcctcggtggacgacgagggctactacacgtacgtcggccggatggacgac
gtgttcaagtcgtccgactaccgcatcagccccttcgagctcgagagcgcgctcatcgag
cacgacgcgatcgcggaggcggcggtcgtgccgagccccgatccgcgccgcctcaccgtg
ccgaaggcgttcgtcgtgctgcgggacggctacgagccgagccgggagctggcgctctcg
atcttccagcacatccgggcggtgctcgccccctacaagagggtccgtcgcatcgagatc
gccgacctcccgaagaccatctccgggaagatccgccgcaccgagctctcccggctcgag
aggcagcggcacgagtcgcccgcggcgcgcggcgagcgcgagttcttcgaggacgacttc
cccgagctgaaggcgagtccatga

DBGET integrated database retrieval system