KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3724Help
Entry
Anae109_3724      CDS       T00559                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00020  Citrate cycle (TCA cycle)
afw00640  Propanoate metabolism
afw00660  C5-Branched dibasic acid metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
afw01200  Carbon metabolism
Module
afw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Anae109_3724
   00640 Propanoate metabolism
    Anae109_3724
   00660 C5-Branched dibasic acid metabolism
    Anae109_3724
Enzymes [BR:afw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Anae109_3724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABS27903
UniProt: A7HGQ7
Position
complement(4339034..4340212)
Genome map
AA seq 392 aa AA seqDB search
MRIHEYQAKELLRGFGVTVLRGGLATTPADAELAAAVLDTPICAIKAQIHAGGRGKAGGV
KLARSPEEARDHAEAMLGMVLVTAQTGPAGQRVRKLYVEEGCRIERELYLGMTVDRETGR
VTIMASREGGVEIEEVAKLHPERILRAEVDPLTGLQANQARGLAFGLGLRGEVASKFVKL
AAGLYRAYVATDASLAEVNPLVVTAEGELVALDAKLELDDNALHRHPDLAALRDPDEEQQ
RELEAKEHDLSYVALEGDIACMVNGAGLAMGTMDMIQLAGGRPANFLDVGGGASEAKVAA
AFKILLADPGVRAVLVNIFGGIMKCDVIAKGILAAARHVNLSVPLVVRLEGTNVELGKEL
LAQSDLEIIPADDLADAARKAVAAARESVRAA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaggatccacgagtaccaggcgaaggagctgctgcgcggcttcggggtgacggtgctg
cgcggagggctcgccaccaccccggccgacgccgagctggcggcggccgtgctggacacg
ccgatctgcgcgatcaaggcgcagatccacgcgggcggacgggggaaggccggcggcgtg
aagctcgcccgctctcccgaggaggcgcgcgatcacgccgaggccatgctcggcatggtg
ctcgtcaccgcgcagaccggcccggcggggcagcgggtccgcaagctctacgtggaggag
ggctgccgcatcgagcgcgagctctacctcggcatgaccgtcgatcgcgagacggggcgc
gtgacgatcatggcgtcccgcgagggaggcgtcgagatcgaggaggtcgcgaagctccac
cccgagcggatcctgcgggcggaggtcgacccgctcaccgggctccaggcgaaccaggcg
cgcggcctcgccttcgggctcggcctgcggggggaggtcgcgagcaagttcgtgaagctc
gccgccggcctgtaccgggcgtacgtcgcgacggacgcctcgctcgcggaggtgaatccg
ctcgtcgtcaccgcggagggtgagctcgtcgcgctcgacgccaagctcgagctcgacgac
aacgcgctccaccgtcacccggacctcgccgcgctccgcgatcccgacgaggagcagcag
cgcgagctcgaggccaaggagcacgacctctcctacgtggcgctcgagggcgacatcgcc
tgcatggtgaacggcgccgggctggcgatgggcaccatggacatgatccagctcgcggga
ggccggcccgccaacttcctcgacgtgggcggcggcgcgagcgaggcgaaggtggccgcc
gcgttcaagatcctcctggcggatcccggcgtgcgcgccgtgctcgtcaacatcttcggc
ggcatcatgaagtgcgacgtcatcgcgaagggcatcctcgcggcggcgcggcacgtgaac
ctctcggtgccgctcgtggtgcggctcgaggggacgaacgtggagctcggcaaggagctc
ctcgcgcagagcgacctcgagatcatcccggcggacgacctcgccgacgcggcccgcaag
gcggtcgcggcggcgcgggagtcggtgcgggcggcgtga

DBGET integrated database retrieval system