KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_4035Help
Entry
Anae109_4035      CDS       T00559                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00010  Glycolysis / Gluconeogenesis
afw00520  Amino sugar and nucleotide sugar metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
afw01200  Carbon metabolism
Module
afw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_4035
   00520 Amino sugar and nucleotide sugar metabolism
    Anae109_4035
Enzymes [BR:afw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Anae109_4035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABS28213
UniProt: A7HHL7
Position
4725992..4726816
Genome map
AA seq 274 aa AA seqDB search
MPNQLRAAPRPWPADVKTLSVDIGGTRLKASVLDRGGKMLVEQVRIDTPYPCPPEVLVEA
LCRLTHDLPRYQRASVGFPGLIRKGVVKQVPSLSRRKPGGPRNPALAARWEGFRLRDALE
EAFGVPTLVANDADVQGSAVVRGEGFELVVTLGTGVGCAMFEDGVVLPHLELSHCHYKRG
RSIDLAIGNAERARIGKKRWNKRVAKSLEWLERMVLFDRMYVGGGNAKHLTLDLGPRVEI
ISNTAGITGGIRLWDRYDGPISRRPAGAGTAATS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatcagctgcgtgccgcgccccgcccgtggccggcggacgtgaagacgttgtcg
gtcgacatcgggggaacccgcctcaaggccagcgtcctcgatcgcggcggcaagatgctg
gtcgagcaggtgcgcatcgacacgccgtacccctgcccgcccgaggtgctggtcgaggcg
ctctgccgcctcacccacgacctgccgcggtatcagcgcgcctcggtggggttcccgggg
ctcatccggaaaggcgtggtgaagcaggtcccctcgctctcgcgccggaagccgggcggt
ccacggaacccggcgctggcggcgcgctgggagggattccggctgcgggacgcgctcgag
gaggcgttcggcgtcccgaccctggtcgcgaacgacgccgacgtgcaggggagcgcggtg
gtgcgcggggagggcttcgagctggtggtgacgctcggcaccggcgtcgggtgcgcgatg
ttcgaggacggcgtggtgctgccccacctcgagctgtcgcactgccactacaagcgcggc
cggtcgatcgacctcgccatcgggaacgccgagcgcgcgcgcatcggcaagaagcggtgg
aacaagcgcgtcgcgaagtccctggagtggctcgagcggatggtgctgttcgaccggatg
tacgtgggcggcgggaacgcgaagcacctcacgctggacctcgggccgcgcgtcgagatc
atctcgaacaccgcgggcatcaccggcggcatccggctgtgggatcgctacgacggcccg
atctcgcggcggcccgcgggcgccggcacggcagcgacctcctga

DBGET integrated database retrieval system