KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_4127Help
Entry
Anae109_4127      CDS       T00559                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00010  Glycolysis / Gluconeogenesis
afw00020  Citrate cycle (TCA cycle)
afw00620  Pyruvate metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
afw01200  Carbon metabolism
Module
afw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_4127
   00020 Citrate cycle (TCA cycle)
    Anae109_4127
   00620 Pyruvate metabolism
    Anae109_4127
Enzymes [BR:afw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Anae109_4127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3 NQRA
Motif
Other DBs
NCBI-ProteinID: ABS28305
UniProt: A7HHV9
Position
complement(4829692..4831416)
Genome map
AA seq 574 aa AA seqDB search
MSTIEVKVPALGDFKDVPVIDVLVKPGEAVSKDDPLVTLESEKATMDVPAPASGTIRDLK
VKVGDRVSEGSVVLTLEAGEAAGAKAAQQAPPPAPAAAKAPAAGRRDGPSAAAAPPRDGP
AAPAPARAEPAPPPPGRSATPAGGGPLEVKVPAIGDFEDVPVIEVLVKAGDGVERDAPLV
TLESEKATMDVPAPAAGTVRELKVKVGDRVSEGSVILVLDAAGAPAGGRPEAAAAPAAPA
APAPAAPPPPEVEARPAPAPPRAPAPAAEEEGRVAVPHASPSVRKLARELGVDLARVQPS
GPRGRILHEDVQRFVKGVVSAAAAGGGAGAGLDLAPWPKVDFAKYGPVEVQPLSRIKRIS
RTNLARNWVMIPHVTQHDEADITELERFRVELNQERAKEGVKVTLLAFVLKACVAALRRF
PEFNSSLEGDQLVLKRYFHIGFAADTPGGLVVPVVKDADRKGVLEIARELAELAQKARDG
KLQLADMQGGTFSVSSLGGIGGTAFTPIINAPEVAILGVSRSATKPVWDGERFAPRLMLP
LSLSYDHRVVDGAAAARFTSHLAQLLADMRRAML
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatcgaggtgaaggtcccggccctcggcgacttcaaggacgtgccggtcatc
gacgtcctcgtgaagccgggcgaggcggtgagcaaggacgatccgctcgtcacgctcgag
tccgagaaggccacgatggacgtgccggcgcccgcgtccggcaccatccgcgatctcaag
gtgaaggtcggcgaccgcgtcagcgaggggagcgtggtgctcaccctcgaggccggcgag
gccgcgggggcgaaggcggcccagcaggctccgccgcccgcgcccgccgccgcgaaggcg
cccgcggcagggcggcgcgacgggccctccgccgcggccgctcccccacgcgacgggccc
gccgcgcccgctccggcccgcgccgagcccgctcctccgccgccggggcggtcggccacg
ccggcgggcggaggaccgctcgaggtgaaggtgcccgccatcggcgacttcgaggacgtg
ccggtgatcgaggtgctggtgaaggccggcgacggggtcgagcgggacgctccgctcgtc
acgctggagtcggagaaggcgacgatggacgtgccggcgccggcggccggcaccgtccgc
gagctcaaggtgaaggtcggcgatcgcgtcagcgaggggagcgtcatcctcgtcctcgac
gccgccggcgcgcccgccggcggccgtccggaggcggccgccgctcccgcggctcccgcc
gccccggcgcccgcggcgccgcccccgcccgaggtcgaggcccggccggccccggcgccc
ccgcgcgctcccgcgccggcggccgaggaggaggggagggtggcggtgccgcacgcctcg
ccttcggtgcggaagctcgcgcgggagctgggcgtggacctggcgcgcgtgcagccctcc
ggtccgcggggccggatcctgcacgaggacgtgcagcggttcgtgaagggcgtcgtgagc
gcggccgcggcgggcggcggcgcgggcgccgggctcgacctcgccccgtggccgaaggtg
gacttcgcgaagtacggcccggtcgaggtgcagccgctctcgcgcatcaagcggatctcg
cgcacgaacctggcgcggaactgggtgatgatcccgcacgtcacgcagcacgacgaggcg
gacatcaccgagctcgagcggttccgcgtcgagctgaaccaggagcgcgcgaaggagggg
gtgaaggtgacgctgctcgccttcgtgctgaaggcgtgcgtggcagccctccggcggttc
ccggagttcaactcctccctcgagggcgatcagctcgtcctgaagcgctacttccacatc
gggttcgcggcggacacgcccggtgggctcgtcgtgccggtggtgaaggacgcggatcgc
aagggcgtcctcgagatcgcgcgggagctcgccgagctcgcgcagaaggcgcgcgacggc
aagctgcagctcgcggacatgcagggcgggacgttctcggtgtcgagcctgggcggcatc
ggcgggacggccttcacgcccatcatcaacgcccccgaggtcgccatcctcggcgtgtcg
cgcagcgcgacgaagccggtgtgggacggggagcggttcgcgccacggctgatgctgccc
ctgtcgctctcctacgaccaccgggtggtcgacggggcggccgccgcacggttcacgagc
cacctcgcgcagctcctcgcggacatgcggcgcgccatgctgtag

DBGET integrated database retrieval system