KEGG   Addendum: AAA26714Help
Entry
AAA26714          CDS       T10000                                 

Gene name
cefD
Definition
(KEGG) isopenicillin-N epimerase (EC:5.1.1.17)
  KO
K04127  isopenicillin-N epimerase [EC:5.1.1.17]
Taxonomy
TAX:1901
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces clavuligerus)
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AAA26714
GB: M32324
UniProt: P18549
AA seq 398 aa AA seqDB search
MAVADWEEARGRMLLDPTVVNLNTGSGGPLPRSAFERVTGFRAHLAAEPMDFLLREVPAL
LWQARESLARLIGGDPLRLALATNVTAAVNLVASSLRLEAPGEILLSDDEYTPMRWCWER
VARRHGLELRTFRLPELPSDPAEITAAAVAAMGPRTRLFFFSHVVSTTGLILPAAELCEE
ARARGITTVVDGAHAPGFLDLDLSRIPCDFYAGSGHKWLLAPTGVGFLHLAPGRLEELEP
TQVSWAYEPPEGSGPPAARDRFGSTPGLRRLECEGTRDICPWLATPESIDFQAELGPGAI
RARRRELTDHARRLLADRPGRTLLTPDSPELSGGMVAYRLPPGTDAAELRRGLWERFRIE
AAVAEQPPGPVLRISANFYTTEEEIDRLADALDALTGE
Reference
PMID:1694525
  Authors
Kovacevic S, Tobin MB, Miller JR
  Title
The beta-lactam biosynthesis genes for isopenicillin N epimerase and deacetoxycephalosporin C synthetase are expressed from a single transcript in Streptomyces clavuligerus.
  Journal
J Bacteriol 172:3952-8 (1990)
DOI:10.1128/JB.172.7.3952-3958.1990
Reference
PMID:2804141
  Authors
Usui S, Yu CA
  Title
Purification and properties of isopenicillin N epimerase from Streptomyces clavuligerus.
  Journal
Biochim Biophys Acta 999:78-85 (1989)
DOI:10.1016/0167-4838(89)90033-2

DBGET integrated database retrieval system