KEGG   Addendum: AAA66357
Entry
AAA66357          CDS       T10000                                 

Gene name
nahE
Definition
(KEGG) trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (EC:4.1.2.45)
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Taxonomy
TAX:303
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas putida)
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AAA66357
GB: U09057
UniProt: Q51947
Structure
PDB: 
6DAO

AA seq 331 aa
MLNKVIKTTRLTAEDINGAWTIMPTPSTPDASDWRSTNTVDLDETARIVEELIAAGVNGI
LSMGTFGECATLTWEEKRDYVSTVVETIRGRVPYFCGTTALNTREVIRQTRELIDIGANG
TMLGVPMWVKMDLPTAVQFYRDVAGAVPEAAIAIYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLKLAPNIRFLPHEDDYYAAARINPERITAFWSSGAMCGPATAIMLRD
EVERAKSTGDWIKAKAISDDMRAADSTLFPRGDFSEFSKYNIGLEKARMDAAGWLKAGPC
RPPYNLVPEDYLVGAQKSGKAWAALHAKYSK
Reference
PMID:8002605
  Authors
Eaton RW
  Title
Organization and evolution of naphthalene catabolic pathways: sequence of the DNA encoding 2-hydroxychromene-2-carboxylate isomerase and trans-o-hydroxybenzylidenepyruvate hydratase-aldolase from the NAH7 plasmid.
  Journal
J Bacteriol 176:7757-62 (1994)
DOI:10.1128/JB.176.24.7757-7762.1994
Reference
PMID:1447127
  Authors
Eaton RW, Chapman PJ
  Title
Bacterial metabolism of naphthalene: construction and use of recombinant bacteria to study ring cleavage of 1,2-dihydroxynaphthalene and subsequent reactions.
  Journal
J Bacteriol 174:7542-54 (1992)
DOI:10.1128/JB.174.23.7542-7554.1992

DBGET integrated database retrieval system